KEGG   Bradyrhizobium sp. S23321: S23_33610Help
Entry
S23_33610         CDS       T01796                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
brs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
brs01100  Metabolic pathways
brs01110  Biosynthesis of secondary metabolites
brs01130  Biosynthesis of antibiotics
brs01230  Biosynthesis of amino acids
Module
brs_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    S23_33610 (trpC)
Enzymes [BR:brs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     S23_33610 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: BAL76562
UniProt: I0G725
Position
complement(3447898..3448716)
Genome map
AA seq 272 aa AA seqDB search
MSDILTKIEAYKREEIATAKRAQPLSAVEAKAKAQAAPRGFVRAIKAKHAKGDYALIAEV
KKASPSKGLIRADFDPPLLAKAYEAGGAACLSVLTDTPSFQGHLDFMVAARAATSLPVLR
KDFMFDTYQVAEARAHGADCILIIMAALDDAVAKDLEDAALAYGMDVLIEIHDRAELDRA
LKLRSPMIGVNNRNLRTFETTLATSEALAPLIPAERLMVGESGIFTPADLARLERVGIST
FLVGESLMRQADVTAATRTLLARETARATGTR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacatcctgaccaagatcgaagcgtacaagcgcgaggagatcgccactgccaag
cgcgcgcagccgctctcggcggtcgaggcgaaagccaaggcgcaagccgccccgcgcggc
ttcgtgcgcgcgatcaaggccaagcacgccaagggcgactacgccctgatcgcagaggtg
aagaaggcctcaccgtcgaaggggctgatccgcgccgatttcgatccgccgctgctcgcc
aaggcctatgaggccggcggtgccgcctgcctctcggtgctgaccgacacaccctcgttc
cagggtcatctcgacttcatggtggcggcgcgcgcggcgacatcgctgccggtgctgcgc
aaggatttcatgttcgacacctaccaggtggccgaggcgcgcgcccatggcgcggactgc
attctgatcatcatggccgcgctcgacgatgcagttgccaaagatctcgaggacgccgcc
ctcgcctacggcatggacgtcctgatcgagatccacgaccgcgccgagctcgatcgcgcg
ctaaaactccgctcgccgatgatcggcgtcaacaaccgcaatcttcgcaccttcgagacc
acgcttgcgaccagcgaggcgctggcgcccctgatccctgcggaacggctgatggtcggc
gagagcggcattttcacgcccgccgacctcgcccggctcgagcgcgtcggcatatcgacc
ttcctggtcggcgaaagcctgatgcggcaggccgacgtcactgccgccacgcgcacgctg
ctcgcgcgcgagactgcgcgcgccacgggcacgcgctga

DBGET integrated database retrieval system