KEGG   Bradyrhizobium sp. S23321: S23_33640Help
Entry
S23_33640         CDS       T01796                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:brs01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:brs01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:brs00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:brs00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:brs00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:brs00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3451871..3452626
Genome map
AA seq 251 aa AA seqDB search
MTDAIRPLIAGNWKMNGLKGAAAEFDAMLNGAAEVAAKADLLVCPPATLIGAFADKARGQ
KVAVGAQDCHPKASGAHTGDIAAEMLADAGATAIIVGHSERRADHGEGDALVRQKAEAAW
RAGITAIVCIGETQGQRDAGQTLDILRGQLDGSLPDGSTAANLVVAYEPVWAIGTGLTPT
AQDVEQIHGFIREFLTSRFKADGARMRILYGGSVKPSNAAELMAVKNVNGALVGGASLKA
ADFLAIAKGCP
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgccatccgccccctgattgccggcaactggaaaatgaacggcctgaagggc
gcggctgccgaattcgacgccatgctcaacggtgcggcagaggtggccgcgaaggccgat
ctcctggtctgcccgccggcgacgctgatcggggccttcgccgacaaggcacgcggccag
aaggtcgcggtgggcgcgcaggattgccatcccaaggcatccggcgcccataccggcgat
atcgccgccgagatgctggcggatgcgggcgcgaccgccatcatcgtcggccattccgag
cgccgcgccgaccatggcgagggcgatgccctggtgaggcaaaaggccgaggccgcatgg
cgcgccgggatcaccgcgatcgtctgcatcggcgagacccaaggccagcgcgatgccggc
cagaccctggacatcctgcgtggccagctcgacggctcgctgccggacggatcgaccgcc
gccaatctggtcgtggcctacgagccggtctgggcgatcgggacgggtctgacccccacg
gcccaggatgtcgagcagattcatggctttatccgggagttcctgacctcccggttcaag
gccgacggcgccaggatgcggatcctctatggcggctcggtcaagccctccaacgcggcc
gaactgatggcggtcaagaacgtcaacggcgcgctggtcggtggtgccagcctgaaggcg
gctgatttccttgcgattgcgaagggctgcccctag

DBGET integrated database retrieval system