KEGG   Bradyrhizobium sp. S23321: S23_33640Help
Entry
S23_33640         CDS       T01796                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
brs00010  Glycolysis / Gluconeogenesis
brs00051  Fructose and mannose metabolism
brs00562  Inositol phosphate metabolism
brs00710  Carbon fixation in photosynthetic organisms
brs01100  Metabolic pathways
brs01110  Biosynthesis of secondary metabolites
brs01120  Microbial metabolism in diverse environments
brs01130  Biosynthesis of antibiotics
brs01200  Carbon metabolism
brs01230  Biosynthesis of amino acids
Module
brs_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
brs_M00002  Glycolysis, core module involving three-carbon compounds
brs_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    S23_33640 (tpiA)
   00051 Fructose and mannose metabolism
    S23_33640 (tpiA)
   00562 Inositol phosphate metabolism
    S23_33640 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    S23_33640 (tpiA)
Enzymes [BR:brs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     S23_33640 (tpiA)
Exosome [BR:brs04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   S23_33640 (tpiA)
  Exosomal proteins of bladder cancer cells
   S23_33640 (tpiA)
  Exosomal proteins of melanoma cells
   S23_33640 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAL76565
UniProt: I0G728
Position
3451871..3452626
Genome map
AA seq 251 aa AA seqDB search
MTDAIRPLIAGNWKMNGLKGAAAEFDAMLNGAAEVAAKADLLVCPPATLIGAFADKARGQ
KVAVGAQDCHPKASGAHTGDIAAEMLADAGATAIIVGHSERRADHGEGDALVRQKAEAAW
RAGITAIVCIGETQGQRDAGQTLDILRGQLDGSLPDGSTAANLVVAYEPVWAIGTGLTPT
AQDVEQIHGFIREFLTSRFKADGARMRILYGGSVKPSNAAELMAVKNVNGALVGGASLKA
ADFLAIAKGCP
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgccatccgccccctgattgccggcaactggaaaatgaacggcctgaagggc
gcggctgccgaattcgacgccatgctcaacggtgcggcagaggtggccgcgaaggccgat
ctcctggtctgcccgccggcgacgctgatcggggccttcgccgacaaggcacgcggccag
aaggtcgcggtgggcgcgcaggattgccatcccaaggcatccggcgcccataccggcgat
atcgccgccgagatgctggcggatgcgggcgcgaccgccatcatcgtcggccattccgag
cgccgcgccgaccatggcgagggcgatgccctggtgaggcaaaaggccgaggccgcatgg
cgcgccgggatcaccgcgatcgtctgcatcggcgagacccaaggccagcgcgatgccggc
cagaccctggacatcctgcgtggccagctcgacggctcgctgccggacggatcgaccgcc
gccaatctggtcgtggcctacgagccggtctgggcgatcgggacgggtctgacccccacg
gcccaggatgtcgagcagattcatggctttatccgggagttcctgacctcccggttcaag
gccgacggcgccaggatgcggatcctctatggcggctcggtcaagccctccaacgcggcc
gaactgatggcggtcaagaacgtcaacggcgcgctggtcggtggtgccagcctgaaggcg
gctgatttccttgcgattgcgaagggctgcccctag

DBGET integrated database retrieval system