KEGG   Bradyrhizobium sp. S23321: S23_33640Help
Entry
S23_33640         CDS       T01796                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    S23_33640 (tpiA)
   01230 Biosynthesis of amino acids
    S23_33640 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    S23_33640 (tpiA)
   00051 Fructose and mannose metabolism
    S23_33640 (tpiA)
   00562 Inositol phosphate metabolism
    S23_33640 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    S23_33640 (tpiA)
Enzymes [BR:brs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     S23_33640 (tpiA)
Exosome [BR:brs04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   S23_33640 (tpiA)
  Exosomal proteins of bladder cancer cells
   S23_33640 (tpiA)
  Exosomal proteins of melanoma cells
   S23_33640 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3451871..3452626
Genome map
AA seq 251 aa AA seqDB search
MTDAIRPLIAGNWKMNGLKGAAAEFDAMLNGAAEVAAKADLLVCPPATLIGAFADKARGQ
KVAVGAQDCHPKASGAHTGDIAAEMLADAGATAIIVGHSERRADHGEGDALVRQKAEAAW
RAGITAIVCIGETQGQRDAGQTLDILRGQLDGSLPDGSTAANLVVAYEPVWAIGTGLTPT
AQDVEQIHGFIREFLTSRFKADGARMRILYGGSVKPSNAAELMAVKNVNGALVGGASLKA
ADFLAIAKGCP
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgccatccgccccctgattgccggcaactggaaaatgaacggcctgaagggc
gcggctgccgaattcgacgccatgctcaacggtgcggcagaggtggccgcgaaggccgat
ctcctggtctgcccgccggcgacgctgatcggggccttcgccgacaaggcacgcggccag
aaggtcgcggtgggcgcgcaggattgccatcccaaggcatccggcgcccataccggcgat
atcgccgccgagatgctggcggatgcgggcgcgaccgccatcatcgtcggccattccgag
cgccgcgccgaccatggcgagggcgatgccctggtgaggcaaaaggccgaggccgcatgg
cgcgccgggatcaccgcgatcgtctgcatcggcgagacccaaggccagcgcgatgccggc
cagaccctggacatcctgcgtggccagctcgacggctcgctgccggacggatcgaccgcc
gccaatctggtcgtggcctacgagccggtctgggcgatcgggacgggtctgacccccacg
gcccaggatgtcgagcagattcatggctttatccgggagttcctgacctcccggttcaag
gccgacggcgccaggatgcggatcctctatggcggctcggtcaagccctccaacgcggcc
gaactgatggcggtcaagaacgtcaacggcgcgctggtcggtggtgccagcctgaaggcg
gctgatttccttgcgattgcgaagggctgcccctag

DBGET integrated database retrieval system