KEGG   Bradyrhizobium sp. S23321: S23_33880Help
Entry
S23_33880         CDS       T01796                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    S23_33880
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    S23_33880
   00020 Citrate cycle (TCA cycle)
    S23_33880
   00620 Pyruvate metabolism
    S23_33880
Enzymes [BR:brs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     S23_33880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3476329..3477696
Genome map
AA seq 455 aa AA seqDB search
MPINILMPALSPTMEKGNLAKWLKKEGDKVKSGDVIAEIETDKATMEVEAIDEGTIAKIL
VPEGTQDVPVNDVIAVLAGEGEDVKAASSAKPSASAAPPKAPEKAAEAPAAAPAPAAAPA
APKAAPPPAAPAPQAAAPAAQSNGHGGRVFSSPLARRLAKDAGIDVSMVSGTGPHGRVVA
RDVEQAKSGKGLKAPAAAPSGGAPGIAPTMSDKQILSLFEPGSYEIIPHDGMRRTIAQRL
TASIQNVPHFYLTIDCDIGKLLAAREEINAAAPKDKEKKPLYKISVNDFVIKAMAVALQK
IPNCNVSWTESGMVKHHHSDVGVAVAMPGGLITPIIRKAETKTLSTISNEMKDFAARARS
RKLKPEEYQGGTTAVSNLGMYGISHFTAVINPPHATILAVGTSEERPVVRGGKIEIAHMM
SVTLSCDHRAIDGALGAELIGAFKQLIENPVMMMV
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcaacatcctgatgcccgctctctcgccgacgatggagaagggcaacctcgcc
aagtggctgaagaaggaaggcgacaaggtcaaatccggcgacgtcatcgccgagatcgag
accgacaaggcgaccatggaggtcgaggccatcgacgagggcacgatcgccaagatcctc
gtgcccgagggtacgcaggacgtcccggtcaacgacgtgatcgcggtgctcgccggcgag
ggcgaggacgtgaaggcggcaagcagcgccaagcccagcgcttcggcggcgccgccgaaa
gctcccgagaaggctgccgaggctcccgctgctgcgccggctccggccgctgcgcctgcc
gcccccaaggctgccccgccgcccgctgctccggcaccgcaggccgcggctcccgccgcg
cagagcaacggccatggcggccgcgtgttctcgtcgccgctcgcccgccgcctcgccaag
gatgccggcatcgatgtgtcgatggtatcaggcacgggcccgcacggccgcgtggtcgcc
cgcgacgtggagcaggccaagtccggcaagggcctcaaggcgcccgcggcggcaccgtcc
ggcggtgcgcctggaatcgcgccgaccatgtcggacaagcagatcctgtcgctgttcgag
cccggctcctacgagatcatcccgcatgacggcatgcgccgcaccatcgcgcagcgcctg
accgcgtcgatccagaacgtcccgcacttctacctcaccatcgactgcgatatcggcaag
ctgctcgccgcgcgcgaggagatcaatgccgctgctcccaaggacaaggagaagaagccg
ctctacaagatctcggtcaacgatttcgtcatcaaggcgatggcggtggcgctgcagaag
atcccgaactgcaatgtaagctggaccgaaagcggcatggtcaagcaccaccattccgac
gtcggcgtcgccgtggcgatgcctggcggcctgatcacgccgatcatccgcaaggccgag
accaagacgctctcgaccatctccaacgagatgaaggattttgccgcgcgcgcgcgttcc
cgcaaattgaaacccgaggaatatcagggcggcaccaccgccgtctcgaacctcggcatg
tacggcatcagccacttcaccgccgtgatcaacccgccgcatgcgaccatcctggcggtc
ggcaccagcgaggagcggcccgtcgtgcgcggcggcaagatcgagatcgcgcacatgatg
agcgtgacgctctcttgcgatcaccgcgccatcgacggcgcgctcggcgccgagctgatc
ggcgcgttcaagcagctgatagaaaaccctgtcatgatgatggtctga

  All links  
No link information was found.   
DBGET integrated database retrieval system