KEGG   Bradyrhizobium sp. S23321: S23_33910Help
Entry
S23_33910         CDS       T01796                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    S23_33910
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    S23_33910
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    S23_33910
Enzymes [BR:brs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     S23_33910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3479529..3480770
Genome map
AA seq 413 aa AA seqDB search
MHDNDNLTIERPTFVTHLECAMEGDHYAADQVHNLSKAGKPLLVRYDLAGVKKALTKDAL
AQRPADMWRYRELLPVRKCKDIVSLGEVTTPLIRLPKLGKKLGGGEIIVKDEGRLPTGSF
KARGLVMAVSMGKALGIKHMAMPTNGNAGAALAAYATSCGIKTTIFCPADTPEVNVSEIE
LQGATVYRVNGYIDDCGKIVGEGKAKVGWFDTSTLKEPYRIEGKKTMGLELAEQLDWDVP
DVIFYPTGGGTGLIGMWKAFDELEKIGFIGSKRPRMVAVQASGCAPMVRAYEAGTEHATR
WEDAHTIASGIRVPQAIGDFLILRAVRQSNGFAIAVDDDKISAALNEVAREEGLLLCPEG
AATYAAYKDSLADGRVSKTDRVMLFNCATGLKYPLPPVTRTLDRHKPIDYTQF
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgcacgacaacgacaacctcaccatcgaacgcccgaccttcgtcacccatctcgaatgc
gcgatggagggcgaccactacgcggctgatcaggtccacaatctctccaaggccggcaag
ccgctcttggtgcgctacgacctcgccggcgtgaagaaggcgctgaccaaggacgcgctg
gcacagcgccccgccgacatgtggcgctaccgcgagctgctgccggttcgcaaatgcaag
gacatcgtctcgctcggcgaagtcaccacgccgctgatccggctgcccaagctcgggaaa
aagctcggtggcggcgagatcatcgtgaaagacgagggacgcctgccgaccggctcgttc
aaggcgcgcggcctcgtgatggcggtgtcgatgggcaaggcgctcggtatcaagcacatg
gcgatgccgaccaacggcaatgccggtgcggcgctcgccgcctacgcgacctcgtgcggc
atcaagaccacgatcttctgcccggccgacacgcccgaggtgaacgtcagcgagatcgag
ttgcagggcgcgaccgtctaccgcgtcaacggctacatcgacgattgcggcaagatcgtc
ggcgagggcaaggccaaggtcggctggttcgacacgtccacgctgaaggagccgtaccgt
atcgaaggcaagaagacgatgggcctggaactcgccgagcagctcgactgggacgtgccc
gacgtgatcttctatccgaccggtggcggcacgggcctgatcggcatgtggaaggcgttc
gacgagctggagaagatcggcttcatcggcagcaagcgcccgcgcatggtcgcggtgcag
gcgtccggctgcgcgccgatggtgcgcgcctatgaggccggcaccgagcatgcgacgcgc
tgggaggacgcccacaccatcgcctccggcatccgcgtgccgcaggcgatcggcgatttc
ctgattttgcgcgcggtgcggcagagcaatggctttgccatcgcggtcgatgacgacaag
atttcggctgcactgaacgaggtcgcgcgcgaggaggggttgttgctgtgccccgagggc
gctgcgacctacgccgcctacaaggacagcctcgccgatggccgcgtcagcaagaccgat
cgcgtgatgctgttcaactgcgcgaccggcctgaaataccccctgccgccggtcacccgg
acgctcgaccgccacaagccgatcgattacacgcagttctag

DBGET integrated database retrieval system