KEGG   Bradyrhizobium sp. S23321: S23_34110Help
Entry
S23_34110         CDS       T01796                                 

Definition
putative sugar hydrolase/Beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    S23_34110
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    S23_34110
Enzymes [BR:brs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     S23_34110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3504806..3505834
Genome map
AA seq 342 aa AA seqDB search
MSTRAFITGVSGTELTAAEREFIRAERPWGFILFKRNVATPAQVAALVAELRAVAGAADA
PVLIDQEGGRVQRLGPPHWPVYPPGAIFASLYDIDSALGLTAARLSARLIAADLADLGIT
VDCLPLADVPVAGADAVIGNRAYGTEPGKVAEIARAVTEGLEQGGVLPVLKHIPGHGRAT
ADTHFKLPTVDTPRVELERTDFAAFKPLADLPMAMTAHVVFSAVDPAHPATTSATMIAQV
IRGVIGFQGLLMSDDVSMNALSGNIAERTRAIFAAGCDVALHCNGNIEEMREVSGQTPEL
SGKALERANAALAARKAPQPFDRAAARAELDALIARANTASA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcgggccttcattaccggcgtatccggaacggaactgaccgccgccgagcgg
gagtttatccgtgccgaacgcccatggggcttcatcctgttcaagcgcaatgtcgcgaca
ccggctcaagttgctgcgctggttgcggaattgcgggcggtcgcaggggcagctgacgcg
cccgtcctgatcgaccaagagggcggacgggtgcagcggctgggtccgccgcactggccg
gtctacccgccgggcgccattttcgcgagtttgtacgacattgattcggccctcgggctc
accgcagcgcgcctcagcgcgcggctgatcgcggccgatctcgccgatctcggcattacc
gtggattgcctgccgctggccgacgtgccggtcgcgggtgccgacgccgtcatcggcaac
cgggcctatggcaccgagccgggcaaggttgccgaaatcgcgcgcgccgtcaccgagggt
ctggagcagggcggcgtgctgccggtgctcaagcacatccctggccacggccgggccacc
gccgatacccatttcaagctgccgacggtcgatacgccccgggtcgagctcgagcgtacc
gacttcgccgcattcaagccgctggcggatctgccgatggccatgactgcacatgttgtg
tttagcgcggtcgaccccgcccatccggcgacgacttctgcgacaatgatcgctcaggtg
attcgtggcgtgatcgggttccagggtttgttaatgagtgatgacgtgtcgatgaacgcg
ctgtcgggaaatattgccgagcggacccgcgccatcttcgcggccggttgcgacgtcgcc
ctgcattgcaacggcaacatcgaggagatgcgcgaagtttccggccagacgcctgaattg
tccggcaaggcgctggagcgggcgaacgccgcgctcgccgcacgcaaggcgccgcagcca
ttcgaccgggcagccgcacgcgccgaactggacgcattgatcgcacgggcaaacacggca
tccgcatga

DBGET integrated database retrieval system