KEGG   Bradyrhizobium sp. S23321: S23_36470Help
Entry
S23_36470         CDS       T01796                                 

Definition
PfkB family carbohydrate kinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    S23_36470
   01230 Biosynthesis of amino acids
    S23_36470
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    S23_36470
   00030 Pentose phosphate pathway
    S23_36470
   00051 Fructose and mannose metabolism
    S23_36470
   00052 Galactose metabolism
    S23_36470
  Energy metabolism
   00680 Methane metabolism
    S23_36470
Enzymes [BR:brs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     S23_36470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3753955..3754920
Genome map
AA seq 321 aa AA seqDB search
MAETPPVQIVTLTINPAVDISTSVKKMLPFTKMRCAEAQRDPGGGGINVARVLNRLGAEA
TAIYPAGGATGQTLAALVEREAVRSIVIPTSNDTREDITVFDETTREQFRLVFPGALLSE
FEWQQCLDAIARISPQAAFVIASGSLPPGVPADFYGRVAQAAKGPAKVIVDTSGSSLKAA
LDVGVYLIKPNLREFQDLAGISSADEPSLIQAGRRLFDRYRIEIIALSMGPGGALLLTRD
VALRAKGLPIELVSVSGAGDSFLGAMVSHLAEGAPLETALRYGVAGGSAALLSPGTGLCL
GADVHRLASSVNVTAVAGDHA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
ttggctgagacaccgcccgtccagatcgtgacgctgaccatcaatccggctgtcgatatc
tcgacttctgtcaagaagatgctgcccttcaccaagatgcgctgtgcggaagctcagcgc
gatcccggcggcggcgggatcaacgtcgccagggttctgaaccggcttggtgccgaggcg
accgcaatctatccagccggcggcgccaccggacaaacccttgcggcactggttgaacgc
gaagccgtacgcagtatcgtgatcccgacgtcgaacgacacaagggaagacatcactgtt
ttcgacgagacgacccgggagcaatttcggctggtctttccaggcgccttgctcagtgaa
ttcgaatggcagcaatgcctcgatgccattgcgcgcatcagtccgcaggctgcattcgtc
atcgcgagcggcagcctgccccccggtgtcccggctgatttctatggcagggtcgcccag
gcagcaaaaggacccgcgaaggtcatcgtggacacgtccggctcctcgctgaaagccgct
ttggatgtgggcgtttatctcatcaagcccaaccttcgggagtttcaggatctggccggg
atcagcagcgccgatgagccttcgctcatccaggcgggccgccgcctgttcgatcgctat
cgcatcgagatcatcgctctgtccatgggccccggcggggcactgctcctgacgcgcgac
gtcgccttgcgggcaaagggcttgcctatcgagctcgtcagtgtttccggcgccggtgac
agcttcctgggcgcgatggtgtcgcaccttgcagaaggcgcaccgctcgagaccgccctg
cgctatggcgtggccggtggttcggctgcgctgctcagtccgggaaccgggctttgcctc
ggagccgacgttcatcgcctcgcttccagcgtgaacgtcacagcggtcgccggcgatcat
gcctag

DBGET integrated database retrieval system