KEGG   Bradyrhizobium sp. S23321: S23_38810Help
Entry
S23_38810         CDS       T01796                                 

Definition
acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    S23_38810
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    S23_38810
Enzymes [BR:brs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     S23_38810
Lipid biosynthesis proteins [BR:brs01004]
 Desaturase
  First
   S23_38810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3959251..3960258
Genome map
AA seq 335 aa AA seqDB search
MSIAEFAPAETARSTIPATKPQLPPGVVTEGPLVEAKLRESYLLLGILYVGAVAGIVWAV
TQGVGKVELFTFAWMFALTTFGIGAGMHRLFVHRSFRTGPIMRVFFCAIAQMAIQGSIAK
WVANHRRHHLYADDVGDPHSPQFDGFGNRYVSALKGFLHAQGSWVFDQATTDNEYYAKDI
LADPIAMFFVRTRWVWYGMSAVFIPGVVGYVFGGVHGMIGCVLFSGLLRAYLLILTSQLT
GSVCHAYGYRRFEVDDASTNEFVTTILTFGEGLHNNHHRFPRDAYISHAWWEIDLNGLII
LGMEKIGLVHDVFHASHRQLELASEAEAQGATTAR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcgctgagttcgccccggccgagaccgcccgaagcaccatccccgccaccaag
ccgcagcttccgcccggcgtcgtcaccgagggaccgctcgtcgaagccaagctgcgcgag
agctatctgttgctcggcattctctatgtcggcgcggtcgcgggcatcgtctgggccgtc
acgcaaggcgtcggcaaggtggagctgttcaccttcgcctggatgttcgcgctcaccacc
ttcggcatcggtgccggcatgcaccgcctgttcgtccatcgcagcttccgcaccggcccg
atcatgcgcgtgttcttctgcgccatcgcccagatggcgatccagggctcgatcgcgaaa
tgggtcgccaaccaccgccgccatcacctctatgccgacgacgtcggcgacccccacagc
ccgcaattcgacggcttcggcaatcgctatgtcagcgcattgaagggtttcctgcacgcc
cagggcagctgggtgttcgaccaggcgaccaccgacaacgaatactacgccaaggacatc
ctcgccgatccgatcgcgatgttcttcgtgcgcacgcgctgggtctggtacgggatgtca
gccgtcttcattccgggcgtggtcggctacgtcttcggcggcgtgcacggcatgatcggc
tgcgtgctgttctccggcctgctccgcgcctatctgctgatcctcaccagccagctcacc
ggctcggtctgccacgcctacggctaccgccgcttcgaggtcgatgacgcctcgaccaac
gagttcgtgaccacgatcctcaccttcggcgagggccttcacaacaaccatcaccgcttc
ccgcgggacgcctacatctcgcacgcctggtgggagatcgatctcaacggcctgatcatt
ctgggcatggagaagatcggtctggtccacgacgtcttccacgcctcgcaccgtcagctt
gaactggcgtccgaagcggaagcgcagggggccaccacggcacgctga

DBGET integrated database retrieval system