KEGG   Bradyrhizobium sp. S23321: S23_39400Help
Entry
S23_39400         CDS       T01796                                 

Definition
(GenBank) hypothetical protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
brs  Bradyrhizobium sp. S23321
Brite
Enzymes [BR:brs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     S23_39400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4023429..4024496
Genome map
AA seq 355 aa AA seqDB search
MVKVLDEHERTMAFAEVALGQIRSLRQTAIPRNYEIWYVYATGYNAPLNKIINETLARHG
KLTEGDLEQIYETYLSHIKTTDRIDKVGARVIGEIDDVMKVLSEALGMTGSYDASLSGAT
ERLSSAQSREQITSIVETLLRSTTEMRETNKALEDRLSLSKNEISNLQQSLEAIRAESLT
DPLTGLGNRKYFDRMIGMAVQNALASGEPLSLLLFDIDHFKSFNDSYGHLTGDQVLRLVG
LSLKQTIKGQDITARYGGEEFAVVLPSTSLRQALTVADHIRRAVMAKELKKKSTGEILGR
VTISVGVSMLKQGDDTEALIERADACLYAAKRNGRNRVICEADPEFVVETHSRVA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtggtcaaggtgctcgacgaacacgaacgcacgatggcgtttgccgaagtggcgctcggt
cagatccggtcgcttcggcaaaccgcgatccctcgcaattacgagatctggtacgtctac
gcgaccggctataacgctccgctcaacaagatcatcaacgagacgctggcgcgccacggc
aagctgaccgaaggcgatctcgagcagatctacgagacctatctctcccatatcaagacc
accgaccgtatcgacaaggtcggtgcgcgcgtcatcggcgagatcgacgacgtgatgaag
gtcttgagcgaagcgctcgggatgaccggctcctacgatgccagcctgtcgggcgcgacc
gaaagactctcgtccgcccagagccgagaacagatcacctcgatcgtcgagacgctgctg
cgttcgaccacggagatgcgcgagaccaacaaagcgctcgaagaccggctctcgctgtcg
aagaacgagatcagcaatctccagcagagcctggaggcgatccgcgccgagagcctgacc
gatccgctcacggggctcggcaaccgcaaatatttcgatcgcatgatcggcatggccgtg
cagaacgcgcttgcgtcgggcgagccgctgtcactgctgttgttcgacatcgaccacttc
aagtcgttcaacgattcctacggccatctcaccggtgaccaggtgctgcggctcgtcggc
ctgtcgctgaagcagaccatcaagggccaggacatcaccgcgcgctatggcggcgaggaa
ttcgcagtggtgctgcccagcacctcgcttcgccaggccctgacggtggccgaccacatc
cgccgtgcggtgatggcgaaggaattgaagaagaagtcgaccggcgagatcctcggccgc
gtcaccatctccgtcggcgtctcaatgcttaagcagggcgacgacaccgaagcgctgatc
gagcgcgcggacgcctgcctctacgccgccaagcgcaacggccgcaaccgcgtgatctgt
gaagccgatccggaattcgtcgtcgagacccacagccgggtggcgtga

DBGET integrated database retrieval system