KEGG   Bradyrhizobium sp. S23321: S23_39400Help
Entry
S23_39400         CDS       T01796                                 

Definition
hypothetical protein
Orthology
K13590  
diguanylate cyclase
Organism
brs  Bradyrhizobium sp. S23321
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4023429..4024496
Genome map
AA seq 355 aa AA seqDB search
MVKVLDEHERTMAFAEVALGQIRSLRQTAIPRNYEIWYVYATGYNAPLNKIINETLARHG
KLTEGDLEQIYETYLSHIKTTDRIDKVGARVIGEIDDVMKVLSEALGMTGSYDASLSGAT
ERLSSAQSREQITSIVETLLRSTTEMRETNKALEDRLSLSKNEISNLQQSLEAIRAESLT
DPLTGLGNRKYFDRMIGMAVQNALASGEPLSLLLFDIDHFKSFNDSYGHLTGDQVLRLVG
LSLKQTIKGQDITARYGGEEFAVVLPSTSLRQALTVADHIRRAVMAKELKKKSTGEILGR
VTISVGVSMLKQGDDTEALIERADACLYAAKRNGRNRVICEADPEFVVETHSRVA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtggtcaaggtgctcgacgaacacgaacgcacgatggcgtttgccgaagtggcgctcggt
cagatccggtcgcttcggcaaaccgcgatccctcgcaattacgagatctggtacgtctac
gcgaccggctataacgctccgctcaacaagatcatcaacgagacgctggcgcgccacggc
aagctgaccgaaggcgatctcgagcagatctacgagacctatctctcccatatcaagacc
accgaccgtatcgacaaggtcggtgcgcgcgtcatcggcgagatcgacgacgtgatgaag
gtcttgagcgaagcgctcgggatgaccggctcctacgatgccagcctgtcgggcgcgacc
gaaagactctcgtccgcccagagccgagaacagatcacctcgatcgtcgagacgctgctg
cgttcgaccacggagatgcgcgagaccaacaaagcgctcgaagaccggctctcgctgtcg
aagaacgagatcagcaatctccagcagagcctggaggcgatccgcgccgagagcctgacc
gatccgctcacggggctcggcaaccgcaaatatttcgatcgcatgatcggcatggccgtg
cagaacgcgcttgcgtcgggcgagccgctgtcactgctgttgttcgacatcgaccacttc
aagtcgttcaacgattcctacggccatctcaccggtgaccaggtgctgcggctcgtcggc
ctgtcgctgaagcagaccatcaagggccaggacatcaccgcgcgctatggcggcgaggaa
ttcgcagtggtgctgcccagcacctcgcttcgccaggccctgacggtggccgaccacatc
cgccgtgcggtgatggcgaaggaattgaagaagaagtcgaccggcgagatcctcggccgc
gtcaccatctccgtcggcgtctcaatgcttaagcagggcgacgacaccgaagcgctgatc
gagcgcgcggacgcctgcctctacgccgccaagcgcaacggccgcaaccgcgtgatctgt
gaagccgatccggaattcgtcgtcgagacccacagccgggtggcgtga

DBGET integrated database retrieval system