KEGG   Bradyrhizobium sp. S23321: S23_41090Help
Entry
S23_41090         CDS       T01796                                 

Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    S23_41090
  Metabolism of other amino acids
   00480 Glutathione metabolism
    S23_41090
Enzymes [BR:brs01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     S23_41090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4195197..4195763
Genome map
AA seq 188 aa AA seqDB search
MMNRRTMLTGLLATTAAATRALADGGMSRIPAYAFSFPALSGDDIRLAAFTGKPLLVVNT
ASLCGYTPQYAGLQEIWSQFRERGLTVIGVPSNDFGGQEPGGTSEITETAHHQYGVTFPI
AAKAVVVGAKAHPFYKWAAEARPRDVPRWNFHKYLIGRDGYIAEVFPSAVEPADTRVKTA
IARALADS
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaccgcaggacgatgctcaccgggcttctggcgacgacggcagccgcgacacgt
gcgctggccgacggcggcatgagccggatcccggcctacgccttctccttccctgctttg
tcgggcgacgacatccgccttgccgctttcaccggcaaaccgctgctcgtggtcaacacc
gcatcgctctgtggctacaccccgcaatatgccggcctgcaggaaatctggagccagttt
cgcgagcgcgggctgaccgtgatcggcgtgccatccaacgatttcggcggacaggagccc
ggcggcaccagcgagatcacggagaccgcgcaccaccaatacggcgttaccttcccgatt
gcggccaaggccgtggtggtcggtgcgaaggcccatccgttctacaaatgggccgccgag
gcacggccccgcgacgttccgcgctggaacttccacaaatacctgatcggccgggacggc
tatatcgccgaggtgtttccttccgcggtcgaaccggcggacacgcgggtcaagaccgcg
atcgccagggcgctcgccgacagttga

DBGET integrated database retrieval system