KEGG   Bradyrhizobium sp. S23321: S23_43030Help
Entry
S23_43030         CDS       T01796                                 

Definition
glutaminase 1
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    S23_43030
   00330 Arginine and proline metabolism
    S23_43030
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    S23_43030
Enzymes [BR:brs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     S23_43030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4391996..4393837
Genome map
AA seq 613 aa AA seqDB search
MTSPPASAWTRSKPPLLRFLDTCLNEFSAETSGHVADYIPELSKADPAYFGISLATLDGH
VYEVGDSRVPFTIQSMSKPFVFALALDLLGAGRVESAIGVEPSGDPFNSIRLNSDNHPFN
PMVNAGAIACTGLIYDSKGPDAFEQIRLALSRFAGRDLAVDEAVYASESQTGDRNRAIGY
LLKTNAVISDNVAGVLDVYFRQCAVLVTARDIAVMAATLANRGINPVTGEQVLSAYAISR
TLSVMTSSGMYDYAGEWIYRIGIPAKSGVGGGILAALPARLGLGSYSPKLDKHGNSVRGI
KVCEALSSHYDLHMLNRSDDARNAVIADYDIGKSPSRRVRRPQEREILAAHEQEVRVIEL
VGTLSLSAVDYVSRRLAGRPRPQFVIFDLHRVTSTTRAGARLVAEAFEELAALNVTVVLS
GVRRASKEWDTLREWTAELKNVRDFYLLDTAIEWAEDQIVYRYGGSIDFHETTELAEQPL
LEGLGEEELTDLASICSIRTYQSGAKILTTGDPADSLFFLRSGAVHVTLPDGVRLATLTA
GMAFGEMALIETTRSADVFADMAATAFEVSLKDFERFRRQHPRASERVMRNLALLLADRL
IVANAKVDILTST
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgccgcccgcctccgcctggacccgctcgaaaccgcctctgctgcggtttctc
gacacctgcctcaacgaattctcggccgagacctccggccacgtcgccgactacattccc
gaactgagcaaggccgaccctgcctattttggcatcagcctcgccacactcgacggccat
gtctacgaggtcggcgactccagggtgcccttcaccatccagtcgatgtcgaaaccgttc
gtgttcgcgttggcgctggatctcctcggcgccggccgggtcgaaagcgcaatcggcgtc
gagccttcgggcgatcccttcaactcgatccggctcaattccgacaaccatccgttcaac
ccgatggtcaatgccggtgcgatcgcctgtaccgggctgatctacgacagcaagggcccg
gatgccttcgagcagatccggctcgcgctcagccgctttgcggggcgcgacctcgccgtt
gacgaggccgtctacgcttccgaaagccagaccggcgaccgcaaccgcgccatcggctac
ctgctcaagaccaacgccgtgatctccgacaatgtcgccggcgtgctcgacgtctatttc
cggcaatgcgcggtgctggtcacggcgcgcgacatcgccgtgatggcggcgacgcttgcc
aaccgcggcatcaatccggtcaccggcgagcaggtgctgagcgcttacgcgatctcgcgt
acgctgtcggtgatgacgtcatcaggcatgtacgactatgccggcgaatggatataccgg
atcggcattcccgccaagagcggcgtcggcggcggcatcctggccgcactgcccgcccgg
ctcggcctcggcagctattcgcccaagctcgacaagcacggcaacagcgtgcgcggcatc
aaggtctgcgaggcgctgtcctcgcattacgacctgcacatgctcaaccgcagtgacgac
gcgcgcaacgccgtcatcgccgactacgacatcggcaagagcccgtcccgccgcgtccgc
cgtccacaggagcgcgagatcctggccgcgcatgagcaggaggtgcgggtcatcgagctg
gtcgggacgctctcgctctcggcggtcgattacgtctcgcgccggctcgccggccggccg
cggccgcaattcgtgatcttcgacctgcatcgtgtcacctcgaccacgcgcgccggtgcg
cggctcgtggccgaggcgttcgaggagctcgccgcgctgaacgtgacggtggtgctgtca
ggcgtcaggcgcgcttccaaggaatgggacacgttgcgggaatggacggcggagctgaag
aacgtccgcgacttctatctgctcgacaccgcgatcgaatgggccgaagatcagatcgtc
taccgctatggcggctcgatcgacttccacgagaccaccgagctggccgagcagccgctg
ctcgaaggcctcggcgaggaagagttgaccgaccttgcctcgatctgcagcatccggacc
tatcagtccggtgcgaagatcctcaccacgggcgatcccgccgattccctgttcttcctg
cgcagcggcgccgtgcatgtcaccctgcccgacggcgtacggctggcgacgctcaccgcc
ggcatggcgtttggcgagatggcgctgatcgagaccacacgttccgccgacgtgttcgcg
gacatggcggcgaccgcgttcgaggtctccctgaaggatttcgagcgtttccgcaggcag
cacccgcgcgccagcgagcgcgtcatgcgcaacctcgcgctgctcctcgccgaccgcctc
atcgtggccaacgccaaggtggatatcctgacgtcgacgtga

DBGET integrated database retrieval system