KEGG   Bradyrhizobium sp. S23321: S23_48870Help
Entry
S23_48870         CDS       T01796                                 

Definition
putative thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    S23_48870
Enzymes [BR:brs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     S23_48870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4995604..4997142
Genome map
AA seq 512 aa AA seqDB search
MQPDPHRPQLKIRRVRLDTGRENVVVISRRSKALRAEIFRGFSRVELRLNGKVLLATLLI
TDDDTLAAHDEIGLSEPAFRRFAEPAGTLVAVTPASPPESLEAVRAKIRGRTLSEAEIGA
IINDLAHYRYSDMEIAAFLIGSASFITSDELLALTGAMAQVGTQLTWPDPIVVDKHCIGG
IPGNRTSMVVVPIVAAHGLPIPKTSSRAITSPAGTADTMEVLARVNVGVEEMKAIVSACN
GCLIWGGHVNLSPADDVLISVERPLSLDTREQMVASIMSKKIAAGSTHLLIDIPVGPTAK
VSSAVEAMRLRKLFEFVGDRFGRTVEVITTDGRQPIGNGIGPVLEANDVMAVLGNDPDAP
RDLREKSLRLAAHLLEYDPKLRGGAGYARARELLDSGAALKQMQKIIDAQGPSTCSTELG
SLSFDVKAASDGVVSAIDCLRLNRLARTAGAPLDKGAGIRLFKKIGDRVEQGEPLYRVYT
FDRPEHDLAASAAAEQTGYIVNGHETLQGKAP
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgcaacctgatccccaccgtccccaactgaagattcgccgcgttcgcctcgacaccggc
cgcgagaacgtcgtcgtcatttcgaggcgatccaaggcgctgcgcgccgagatctttcgc
ggcttcagccgcgtcgaactccgcctcaacggcaaggtgctgctggcgacgctgctgatc
accgatgacgacacgctagccgcccacgacgagatcggcctgtccgagcccgcattccgc
cgtttcgccgaaccggccggcacgctggtcgcggtcacacccgcctctcctcccgagagc
ctcgaggcggtgcgcgcgaagatccgcggccgcacattgagcgaggccgagatcggcgcg
atcatcaacgacctcgcacattatcgctactccgacatggagatcgccgccttcctgatc
ggctcggcgagcttcatcaccagcgacgagctcctggccctcaccggcgcgatggcgcag
gtcggcacgcaattgacgtggccggatccgatcgtcgtcgacaagcactgcattggcggc
attccgggcaatcgcacctcgatggtggtggtgccgatcgtcgccgcgcatggcctgccg
atccccaagacctcctcgcgcgccatcacctcgccggccggcaccgccgacacgatggag
gttctggcgcgcgtcaatgtcggcgtcgaggagatgaaggcgatcgtctcggcgtgcaac
ggctgcctgatctggggcgggcacgtgaatttgtcgccggccgacgacgtcctgatctcg
gtcgagcgccccctgagcctcgatacccgcgagcagatggtcgcctccatcatgtcgaag
aaaatcgcggcgggctcgacccatttgttgatcgacattccggtcgggccgaccgcaaag
gtcagcagcgccgtcgaggcgatgcggctgcgaaagctgttcgaattcgtcggcgaccgg
ttcggccgcacggtcgaggtgatcacgaccgacggccgccagccgatcggcaacggcatc
gggcccgtgctcgaggccaatgacgtaatggcggtgctcggcaacgatccggacgcaccg
cgcgatctgcgcgagaaatcgctgcggctcgccgcgcacctgctggaatacgatccgaag
ctgcgtggcggcgccggctatgcgcgggcgcgcgaactgctggacagcggcgcggcgctg
aagcagatgcaaaagatcatcgacgcccagggcccctcgacctgcagcaccgagctgggc
tcgctcagcttcgacgtcaaggctgcgagcgacggcgtggtgtccgcgatcgattgcctg
cgcctcaatcgcctcgcccgaaccgccggcgcaccgctcgacaagggcgccggcatccgc
ctgttcaagaagatcggcgaccgggtcgagcaaggcgagccgctctatcgcgtctacacg
ttcgaccgccccgagcatgatctggctgcctctgcggccgcagagcagaccggctacatc
gtcaacggtcacgagaccctccagggcaaggcgccgtga

DBGET integrated database retrieval system