KEGG   Bradyrhizobium sp. S23321: S23_49380Help
Entry
S23_49380         CDS       T01796                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:brs00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5047397..5048323
Genome map
AA seq 308 aa AA seqDB search
MEWRALPNPALNPPSPTAKAGGMNASPSSSVPQAGSAGPDVLRTLLERPIPAVMGVLNIT
PDSFSDGGEFIAPALALQRARAMIDAGVDIIDIGAESTRPYTGARPVTAADEIARLKPVL
ADLVALGVPVSIDSMKAEVVAFALDQGVAIANDVWGLQRDAAMAPLVAARSVPVIVMHNR
DNVDSTIDIVADMKTFFLLSLDIAAKAGIAREKIVLDPGIGFGKTAEQSMIALARLREFD
MFGLPILVGASRKRFIASVSPSEPKERLAGSIAAHLIAAQHGARIIRTHDVAETLQALRV
AHAIESKQ
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggagtggcgcgcactgcccaatcccgccttgaatcccccctccccgaccgctaaagcg
ggcggcatgaacgcctcgccatcctcatccgtcccccaggccggctcggccgggcctgac
gtgctgcggacattgctggaacggccgatcccggcagtgatgggcgtgctcaacatcacc
ccggactccttctccgacggcggcgagttcattgcgcccgcgctggcgctgcagcgggca
cgggcgatgatcgatgccggcgtcgacatcatcgacatcggcgcggaatcgacccggccc
tacacgggcgcccggccggtcacggcggcggacgagatcgcccggctgaagccggtgctg
gccgacctggtggcgctcggcgtgcccgtgtcgatcgacagcatgaaggcggaggtcgtg
gctttcgcactcgaccagggcgttgcgatcgccaacgacgtctggggcctgcaacgcgac
gccgccatggcgccgctggtcgccgccaggagcgtccccgtcatcgtcatgcacaaccgc
gacaacgtcgattctaccatcgacatcgtcgcggacatgaagacgttcttcctcctctcg
ctggatatcgccgccaaagccggcattgcgcgcgagaagatcgtgctcgatcccggcatc
ggctttggcaagaccgccgagcagagcatgatcgcgctggcgcgcttgcgcgaattcgac
atgttcggcctaccgatcctggtcggcgcctcgcgcaagcgcttcatcgcctcggtgtcg
ccgtcggagccgaaagaacggctcgcgggctcgatcgccgcgcacctgatcgccgcccag
cacggcgccaggatcatccggacccacgatgtcgccgagaccttgcaggccctgcgggtg
gcacacgcaatcgagagcaagcaatga

DBGET integrated database retrieval system