KEGG   Bradyrhizobium sp. S23321: S23_49400Help
Entry
S23_49400         CDS       T01796                                 

Gene name
folK
Definition
6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    S23_49400 (folK)
Enzymes [BR:brs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     S23_49400 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5048690..5049181
Genome map
AA seq 163 aa AA seqDB search
MASVLIALGGNVGDVRATFGKAIAHVCGMTQGVLVARSSDYATPPWGDEDQDPFINACVE
IETELDPHALLFVLQKVEQKFGRTRTKERRWGPRTLDLDMIAYDDVSMQKPDLTLPHPRL
FERAFVLVPLAEIAPDRMISGIRVRDGLASVSTQGIERLPDTG
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcgtcctcattgcgctcggcggcaatgtcggcgatgtccgtgcgacgttcgga
aaggccatcgcgcatgtctgcggcatgacgcaaggcgtgctggtcgcgcgctcctcggac
tatgcgacgccgccctggggcgacgaggaccaggatcccttcatcaacgcctgcgtcgag
atcgagaccgagctcgatccgcacgcgctgctgttcgtgctgcagaaggtcgaacagaaa
ttcggtcgcacacgcaccaaggagcggcgctggggtccacgcacgctcgatctcgacatg
atcgcctatgacgatgtgtccatgcagaagcctgatctgaccttgccgcatccgcgcctg
ttcgaacgcgccttcgtgctggtgccgctcgccgaaatcgcgcccgaccgtatgatctcg
ggcattcgtgtccgtgacgggctcgccagcgtctcgacgcaaggcattgagcggctgccg
gataccggttaa

DBGET integrated database retrieval system