KEGG   Bradyrhizobium sp. S23321: S23_49640Help
Entry
S23_49640         CDS       T01796                                 

Gene name
fadB
Definition
enoyl-CoA hydratase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    S23_49640 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    S23_49640 (fadB)
   00650 Butanoate metabolism
    S23_49640 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    S23_49640 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    S23_49640 (fadB)
   00310 Lysine degradation
    S23_49640 (fadB)
   00360 Phenylalanine metabolism
    S23_49640 (fadB)
   00380 Tryptophan metabolism
    S23_49640 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    S23_49640 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    S23_49640 (fadB)
   00281 Geraniol degradation
    S23_49640 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    S23_49640 (fadB)
   00627 Aminobenzoate degradation
    S23_49640 (fadB)
   00930 Caprolactam degradation
    S23_49640 (fadB)
Enzymes [BR:brs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     S23_49640 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5074748..5075527
Genome map
AA seq 259 aa AA seqDB search
MSTFEHIIVESIGAVGIIKLNRPKMLNALSFGVFREIAAAVDDLEGDDAIGCIVVTGSEK
AFAAGADIKEMQPKGFIDMFSEDFAAIGGDRVARCRKPTIAAVAGYALGGGCELAMMCDF
IIAADTAKFGQPEITLGTIPGIGGTQRLTRAIGKAKAMDLCLTGRMMDAAEAERSGLVSR
IVPADKLMEEVMAAADKIASMSRPAVAMAKEAVNRAFETTLAEGMSVERNLFHATFALED
RSEGMAAFIEKRKPVNKNR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgttcgaacacatcatcgtcgaaagcatcggagcggtcggcatcatcaagctg
aaccggccgaagatgctcaacgcgctctccttcggagtcttccgcgagatcgcggcggcc
gtcgacgatctcgagggcgatgacgcgatcggctgcatcgtcgtgaccggcagcgaaaag
gccttcgccgccggcgccgacatcaaggagatgcagccgaagggcttcatcgacatgttc
tccgaggatttcgccgcgatcggcggcgatcgcgtcgcgcgctgccgcaagccgaccatc
gccgcggtcgcgggctacgcgctcggcggcggctgcgagctcgccatgatgtgcgacttc
atcatcgccgccgacaccgccaagttcggccagcccgagatcacgctcggcaccattccc
ggcatcggcggcacccagcgcctgacccgcgcgatcggcaaggccaaggcgatggacctc
tgcctcaccggccgcatgatggatgcggccgaagccgagcgcagcggcctcgtcagccgc
attgtgcccgcagacaagctcatggaagaagtcatggccgccgcggacaagatcgcgtcg
atgtcgcggcccgcggtcgcgatggccaaggaggcggtgaaccgcgccttcgagaccacg
ctcgccgagggcatgagcgtcgagcgcaacctgttccacgcgacctttgcgctggaagac
cgctccgagggcatggccgccttcatcgagaagcgcaagccggtgaacaagaaccggtaa

DBGET integrated database retrieval system