KEGG   Bradyrhizobium sp. S23321: S23_51670Help
Entry
S23_51670         CDS       T01796                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    S23_51670 (rbsK)
Enzymes [BR:brs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     S23_51670 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5314231..5315148
Genome map
AA seq 305 aa AA seqDB search
MGRVFVAGSINMDVVATADRHPKVGETVAGKQVLYFPGGKGANQAVAASRLGAQTTLIGR
LGKDSFGAELKAFLADQGIDLGYLQETAEAHTGTAIITVAASDNTIVVIPGSNALVAADD
VRVVPLLKGDVAVSQFEIPLPTIAVFFQRAREAGATTVLNPAPAQTMSRELLALVDVLVL
NETELGFLAGVELSEDDSAARIIEVARRLQARADQTICVTLGKRGVLARAGSEEFAVPGR
AVKAVDTTGAGDCFVGALAAQLADGVALRTALTFANAAASISVQRMGAGPSMPTAAEVAA
VLNAG
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggggcgcgtcttcgtcgccggcagcatcaacatggatgtggtggcgaccgccgatcgc
cacccgaaagtcggcgagaccgtcgccggcaagcaggtgctgtattttccgggcggcaag
ggtgccaaccaggccgtggcggcgtcgcggctcggcgcgcagaccacgctgatcggccgg
ctgggcaaggattccttcggcgctgaactgaaagccttcctcgccgatcagggcatcgat
ctcggctatctccaggagacggccgaggcgcataccgggaccgccatcatcacggtggcg
gcgtccgacaacaccatcgtcgtcattcccgggagcaatgcgctggtcgccgccgacgac
gtccgcgtcgttccgctgctgaagggcgacgtcgcggtcagccagttcgaaattccgctg
ccgacgattgccgtgtttttccagcgcgcgcgagaggccggcgccacgacggtgctcaat
ccggcgccggcgcagacgatgtcgcgtgagttgctcgcgctcgtcgacgtcctcgtgctg
aacgagaccgaactcggcttcctcgccggtgtggagctttcggaggacgatagcgctgcg
cgcatcatcgaggtggcgcgacggcttcaggcgcgcgcggaccagaccatctgcgtcacg
ctcggcaagcgcggggtgctggcacgtgctggcagcgaggaatttgccgtgcccggccgt
gcggtgaaggcggtcgataccaccggcgccggcgattgtttcgtcggcgcgctcgcggcg
cagctggcagacggagtggccttgcgcaccgcgctcaccttcgccaatgccgccgcctcg
atctcggtgcagcgcatgggcgccgggccgtcgatgccgacggcagcggaggtggcggcg
gttctcaacgcaggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system