KEGG   Bradyrhizobium sp. S23321: S23_53580Help
Entry
S23_53580         CDS       T01796                                 

Definition
putative alkaline phosphatase transmembrane protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    S23_53580
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    S23_53580
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    S23_53580
Enzymes [BR:brs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     S23_53580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5520065..5521630)
Genome map
AA seq 521 aa AA seqDB search
MATLRAPRAWTRRQFLVRSTSSLAIAALAKPSISRAADRPQIAGGIQSGDVSDGSAVIWA
RADRPARMQVECSTVESFRTIIASASRDALPDADFTSKLLLSDLPPGQDIFYRVRFDDIA
AGITGESRVGHFGTAPAEGRSISFLWSGDVAGQGWGIDIARGGYRSYRTMLDNRPDFFIH
SGDHIYADCTIPSEQKLPNGEVWRNIVTEEKAEVAHTLAQFRGNYKYNHLDEHFRAFHAE
VPMFAQWDDHEVTNDWSPAASHDDAGYEDDGTPRLVARARRAFFDFMPIRDVGAGQGRVY
RRIAYGPLLDVFMIDMRSYRDDNWNKGDDHRGWILGAEQLAWLKRELAASRATWKVIAAD
LPIGLVSMDAVALGNGPPDRREHEIADLLAAIKRAGVRNIVWLTADMHYTAAHYYDPNRA
QFQDFEPFWEFVSGPLHAGTWGPGELDDTFGPVAMYQHGCSEAQGENLAPCFGLQFFGRV
DIDGASGVMTVTLKDVDDRDLWSVDIVPQPQARPAVVAQHS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgctccgcgccccgcgcgcctggacccggcggcagttcctggtccgctccacc
tcaagccttgccatcgctgcgcttgcgaaaccctcgatcagtcgtgctgccgaccgaccg
cagatcgccggcggcatccagtccggcgacgtctcggacggctcagcggtgatctgggca
cgcgccgatcggccggcgcgcatgcaggtggaatgctcgaccgtcgagagtttcaggacc
atcattgcctccgcgtcgcgcgatgcgttgccggatgctgatttcacgtcaaagctgctg
ttgagcgacctgccgcccgggcaggacatcttctaccgcgtgcgcttcgacgacatcgcc
gccggcatcaccggcgaaagccgcgtcggccatttcggcaccgcgccggccgagggccgg
tcgatttcgttcctgtggtccggcgatgtcgcagggcagggctggggcatcgacatcgcg
cgcggcggctatcgcagctatcgcaccatgctcgacaaccgccccgatttcttcatccac
tccggcgatcacatctacgccgactgcacgattccttccgagcagaaactgccgaacggc
gaggtctggcgcaacatcgtcaccgaggaaaaggccgaggtcgcgcacacgctggcgcag
tttcgcggcaactacaaatacaaccatctcgacgagcacttccgtgccttccatgccgag
gtgccgatgttcgcccagtgggacgaccacgaggtcaccaacgactggtcgccggctgcc
agtcatgacgacgcaggttacgaggacgacggcacgccgcggctcgtcgcgcgcgcccgc
cgcgccttcttcgacttcatgccgatccgcgacgtcggtgcggggcaggggcgggtctat
cgcaggatcgcctacggtccgctgctcgacgtcttcatgatcgacatgcgcagctatcgc
gacgacaactggaacaagggcgacgatcatcgtggctggatcctgggcgctgagcaactc
gcctggctgaagcgggagctcgccgcctcgcgtgcgacctggaaggtgatcgcggccgac
ctgccgattggcctcgtcagcatggatgccgtcgcgctcggcaatgggccgcccgaccgg
cgcgagcacgagatcgccgatctgcttgccgccatcaagcgcgcgggcgtccgcaacatc
gtctggctcacagccgacatgcattacaccgccgcgcattattacgatccgaacagggcg
caattccaggatttcgagccgttctgggagttcgtctccggccctctgcatgccggcacc
tgggggccgggcgagctcgacgacaccttcggcccggtcgcgatgtaccagcacggttgc
agcgaagcgcagggcgagaacctggcgccctgcttcggtttgcagttcttcggccgtgtc
gacatcgacggcgccagcggcgtcatgacggtgacgctgaaagacgtcgacgatcgcgat
ctctggtccgtcgatatcgtgccgcagccgcaggcgcgcccggccgtggtggcgcagcat
tcctag

DBGET integrated database retrieval system