KEGG   Bradyrhizobium sp. S23321: S23_55560Help
Entry
S23_55560         CDS       T01796                                 

Gene name
aceA
Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:brs01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:brs00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5724297..5725931)
Genome map
AA seq 544 aa AA seqDB search
MNYQPRGINALQRPASYQSEIEAAQALLETKPTWNGVKAEAIARMRLQNRFKTGLDIARY
TAALMRADMAAYDADPTKYTQSLGCWHGFIAQQKLISIKKHFGGKTDRRYLYLSGWMIAA
LRSEFGPLPDQSMHEKTSVPALIEELYTFLRQADSRELNDIFRNLDKARKEGDKNREKEL
IEKIDNFQTHVVPVIADIDAGFGNAEATYLLAKKMIEAGACALQIENQVSDEKQCGHQDG
KVTVPHEVFLAKIRACRHAFLELGVEDGVVVTRTDSLGAGLTQQIAVSHKPGDIGDQYNS
FLDCEEVTPENARNGDVIINRNGKMLRPKRLPSNLYQFRAGTGEDRCVLDSITSLQNGAD
LLWIETEKPHIEQIAKMVDRIRKVVPNAKLAYNNSPSFNWTLNFRWQVYDAMKEAGKDVS
KYNRAELMKPEYDDTPLAIEADERIRTFQADSAKRAGIFHHLITLPTYHTAALSTDNLAR
EYFGEQGMLGYVKNVQRAEIRQGIACAKHQNMAGSDIGDDHKEYFAGEAALKAGGAHNTM
NQFG
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaactaccagccccgtggcatcaacgccctgcagcgcccggcctcgtatcagagcgag
atcgaggccgcccaggcgctcctcgaaaccaagccgacctggaacggggtgaaggccgag
gccatcgcgcgcatgcgcctgcagaaccgcttcaagaccggcctcgacatcgcccgctac
accgcggcgctcatgcgggccgatatggcggcctatgatgccgatccgaccaagtacacc
cagtcgctgggttgctggcacggcttcatcgcgcagcagaagctgatctcgatcaagaag
cacttcggcggcaagaccgatcgccgctacctctatctctccggctggatgatcgcggcg
ctgcgctccgagttcggaccgctgcccgaccagtcgatgcacgagaagacctcggtgccg
gcgctgatcgaagaactctacaccttcctgcgtcaggccgactcgcgcgagctcaacgac
atcttccgcaacctcgacaaggcgcgcaaggaaggcgacaagaaccgcgagaaggagctg
atcgagaagatcgacaacttccagacccatgtcgtccccgtcatcgccgacatcgacgcg
ggcttcggtaacgccgaggcgacctatctgctcgccaagaagatgatcgaggcgggcgcc
tgcgcgctgcagatcgagaaccaggtctctgacgagaagcagtgcggccaccaggacggc
aaggtcaccgtgccgcacgaggtgttcctggccaagatccgggcctgccgccatgcgttc
ctcgagctgggcgtcgaagacggcgtcgtcgtgacccgcaccgactcactaggcgccggc
ctcacgcagcagatcgccgtcagccacaagccgggcgatatcggcgatcagtacaacagc
ttcctcgattgcgaggaagtgacgccggagaacgcccgcaacggcgacgtcatcatcaat
cgcaacggcaagatgctgcgtccgaagcgcctgcccagcaatctctaccagttccgcgcc
ggaacgggcgaagatcgctgcgtgctcgacagcatcacctcgctgcagaacggtgcggac
ctgctctggatcgaaaccgagaagccgcatatcgagcagatcgccaagatggtcgatcgg
atccgcaaggtggttccgaacgccaagctcgcctacaacaactcgccgtcgttcaactgg
accctcaacttccgttggcaggtctacgacgcgatgaaggaagcgggcaaggacgtcagc
aagtacaaccgggccgagctgatgaagccggaatacgacgatacgccgctggccatcgaa
gccgacgagcgcatccgcaccttccaggccgattccgccaagcgtgccggcatcttccac
cacctgatcacgttgccgacctatcacacggcagcgctctcgaccgacaatctcgcacgc
gagtatttcggcgagcagggcatgctgggctacgtcaagaacgtccagcgcgcggaaatc
cgccagggcatcgcctgcgccaagcatcagaacatggccggctccgacatcggcgacgac
cacaaggaatacttcgccggcgaggctgccctgaaggcgggcggcgctcacaacacgatg
aaccagttcggctaa

DBGET integrated database retrieval system