KEGG   Bradyrhizobium sp. S23321: S23_57780Help
Entry
S23_57780         CDS       T01796                                 

Gene name
xynA
Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
brs  Bradyrhizobium sp. S23321
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5972436..5973503
Genome map
AA seq 355 aa AA seqDB search
MLKLDRREFLIGGAAALAASASASAVPASKLAQRRPGFGAAATLWDLQADPRLGEAISTY
CTQVVPVLELKWPMLRPNAHTFNFERADAILDFARDNDLTMRGHTLAWYHDIPDWTKQIK
DTKGVERAYVDHIGTVVSYYKDKLTSWDVVNEPIPDNPKKITDRRDTFWTQHLGSNWIPL
AFRTAAAADPFVKLAINEYDIESAKDSFIAKRAAYRNLIMDLLDRGVPLHAVGLQSHLHA
ELEIDTHGLAEFVTELRSWGLDVLVTELDVDDQKLTGSPAERDAIVAKRVNDLLTAVSTS
GPVRSILTWGLSDRYSWINGTFARADKQPNRPLPLDGEFKPKPFMDVISKFTRDA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
ttgctcaagctcgacagacgcgaatttctgatcggcggcgccgcagcgcttgcggcgagc
gcatcggcgtctgcggtgccagcgtcgaaactggcccagcgccgtccgggttttggtgcc
gcggccacgctctgggacctgcaggccgatcccagactcggcgaagccatcagcacctat
tgcacgcaggtagtgccggtgctcgagctgaaatggccgatgctgcggccgaacgcgcac
acgttcaacttcgagcgcgccgacgccatcctggatttcgcgcgggacaacgatctgacg
atgcgcggccacacgctcgcctggtatcacgacattccggactggaccaagcagatcaag
gataccaagggtgtcgaacgcgcctatgtcgaccacatcggcaccgtcgtctcctattac
aaggacaagctgacgtcgtgggacgtcgtcaacgaaccgatcccggacaatcccaagaag
atcaccgaccggcgcgacacgttctggacccagcacctgggcagcaactggattccgctg
gccttccgcacggcggccgcggccgatcccttcgtcaagctcgcgatcaatgaatacgac
atcgagtcggcaaaggactcgttcatcgccaagcgcgcggcctaccgcaatctcatcatg
gacctgctcgaccggggcgtgccattgcacgccgtgggactgcaatcgcatctgcatgcc
gagctcgagatcgacacgcatgggctggccgagttcgtcaccgagctgcgctcctggggc
ctcgacgtcctcgtcaccgagctcgacgtcgacgaccagaagctgacgggcagtccggcg
gagcgcgacgccatcgtcgccaagcgcgtcaacgatctgctgacggcggtttcgaccagc
ggaccggttcgctcgatcctgacctggggcctttcggatcgctacagctggatcaacggc
accttcgcccgcgcggacaagcagccgaaccgcccgctgccgctcgacggcgagttcaag
ccgaagccgttcatggacgtcatcagcaagttcaccagggatgcttga

DBGET integrated database retrieval system