KEGG   Bradyrhizobium sp. S23321: S23_57800Help
Entry
S23_57800         CDS       T01796                                 

Definition
putative methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
brs  Bradyrhizobium sp. S23321
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5974570..5975364)
Genome map
AA seq 264 aa AA seqDB search
MSDAAAARARYVALIARRERISSPRLLAALGAVPREDFLAKGPWRIKSEAARSYRLTPDA
DPVHLYDNVLVAIDARRKLDTGLPSLWAHFVDLLDVGEKDRVVQIGCGLGYFSAVLSKIV
GPRGRVHAIECDERLAARAATNLRAYGNVEVVHGDGCRHLGEPADVIIVHAGFSQPHPLW
LQSLRPRGRLLVPLTQRDREGAALKITRKGKVFEAEAVQQIRIFPGRGRGTTALDDRVAD
WWQRASALAPLRFRGIEQGLPSDG
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgccgccgccgcgcgtgcgcgctacgtcgcgctgattgccaggcgggagcgg
atttcctcgccgcgcctgctggcggcgctcggtgccgtgccgcgcgaggattttctggcg
aaggggccctggcgcatcaagagcgaggcggcgcgcagctaccggctgacgcctgacgcc
gatccggttcatctctacgacaacgtgctggtcgcgatcgacgcgcgccgcaagctcgac
accgggctgccgagcctgtgggcgcatttcgtcgatctgctcgacgtcggagagaaggac
cgcgtggtccagatcggctgcgggctcggctatttctcggcggtgctgtcgaagatcgtg
ggtcccaggggcagggtgcacgccatcgaatgcgatgagcggctcgccgctcgcgccgcg
accaaccttcgcgcctatggcaatgtcgaggtcgtgcacggtgacggatgccggcatctc
ggcgaaccggccgacgtgatcatcgtgcatgccggcttctcgcagccgcatccgctctgg
ctccagtcgctccgcccgcgtggccgccttctggtgccgctgacccagcgcgaccgcgag
ggcgccgcgctcaagatcacgcgcaagggcaaggtgttcgaggccgaagcggtgcagcag
atccggatctttcccggccggggccgcggtacgaccgcgctggatgaccgcgtcgccgac
tggtggcagcgcgcctccgccctggcgccgctgcgtttccgtggaatagagcaggggctg
ccgtcggatggctaa

DBGET integrated database retrieval system