KEGG   Bradyrhizobium sp. S23321: S23_58280Help
Entry
S23_58280         CDS       T01796                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:brs02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:brs02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6028948..6030144)
Genome map
AA seq 398 aa AA seqDB search
MSVAFAGNSTTSPSREAGPLRVMIVDDSVVIRGLISRWVGAEHDMEVAASLRTGLEAVNQ
IERINPDVAVLDIEMPELDGISALPQLLAKKRDLVIIMASTLTRRNAEISFKALSLGAAD
YIPKPESTREASAADIFHHDLIQKIRHLGARLRRKPAVGSPPLAPASPSPAPAARGPVAR
PAAPAPAVPAPSSGTLSTRPFSSQAPKVLLIGSSTGGPQALMALVTELGPVIDRVPVLIT
QHMPPTFTTILAEHLARSSRKPAAEAVDGELVKPGRIYLAPGGKHMRVVRNGADAAIALD
DGPAVNFCKPAVDPLFTSAIDIWHGNILSVILTGMGSDGMRGGKDIVAAGGSVIAQDEAS
SVVWGMPGAAANAGICSAILPLNQIGSKVNRLFAGDRT
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttgcgttcgcaggtaattcgaccaccagcccgtcgcgcgaagccgggccgctg
cgggtgatgatcgtcgacgactccgtcgtcatacgcggcctgatttcgcgctgggtcgga
gccgagcacgacatggaggtcgcagcttcgctgcgcaccgggctcgaggcggtcaaccag
atcgaacgcatcaaccccgacgtcgccgtgctcgacatcgaaatgcccgagctcgacggc
atctcggcgctgccgcaactgcttgcgaagaagcgcgatctcgttatcatcatggcctcg
acgctgacgcgccgcaacgcggagatcagcttcaaggcgctgtcgctcggcgcggccgat
tacattccgaagccggagtcgacgcgcgaggcgtcggccgccgacattttccaccacgac
ctgatccagaagatccgtcacctcggtgcgcggctgcgccgcaagcccgccgttgggagc
ccgccgctggcgcccgcgagcccgagcccggctccggccgcacgcggaccagtcgcgcgc
cccgctgcgccggcgcctgccgtgcctgcgccgtcgtcggggacactgtccacgcgcccg
ttctcgagccaggcacctaaggtgctgctgatcggctcctcgaccggcggcccgcaggcg
ctgatggcgctcgtcaccgaactcggcccggtgatcgaccgcgtcccggtgctgatcacg
cagcacatgccgccgaccttcaccaccattcttgccgagcatctggcgcgctccagccgc
aagccggcagccgaggcggtcgacggcgagctggtcaagccgggacggatttatctggcg
cccggcggcaagcacatgcgcgtcgtgcgcaacggcgcggacgcagcgatcgcactcgac
gacggccccgccgttaatttctgcaagcccgcggtcgatccgctcttcacgtccgccatc
gacatctggcacggcaacatcctctccgtgatcctgacgggcatgggctcggacggcatg
cgcggcggcaaggacatcgtcgcggccggcggcagcgtgatcgcgcaggatgaagcctcc
agcgtcgtctggggcatgccgggcgcggctgccaatgccggcatctgttcggcgatcctg
ccgctcaaccagattggctccaaggtcaatcgcctgttcgcgggggaccgcacgtga

DBGET integrated database retrieval system