KEGG   Bradyrhizobium sp. S23321: S23_58330Help
Entry
S23_58330         CDS       T01796                                 

Definition
putative inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:brs00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6034972..6035796
Genome map
AA seq 274 aa AA seqDB search
MKRIIDGQAASGLMEPLTALVVKAGEAILAVNRSAMRVDGKQDGSPVTEADLAADRIVAD
GLAQLAGDVPTLSEERTHLASPPFLDSFFLIDPLDGTKEFVAGRDEFTVNLALVTRGVPL
LGIVSAPALGLLWRGIVGRGAERVRFDGATIGAAEPIHTRRLPIAGEPWIAAVSRSHGDP
KTEAFIDGRPNAVRKTVGSAVKFGRIAEGSADIYPRFGPTCEWDVGAGCAVVTAAGGRVT
DGKGGELRFGQRGDTGFIIPDFIAWGDPQAAGSY
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcggatcatcgacggccaagccgcatccggcctgatggagccgctcaccgcgctg
gtggtgaaggcgggcgaagcgatcctcgcggtcaaccgctccgcaatgcgggtcgacggc
aagcaggatggctcgcccgtgaccgaggccgaccttgccgccgaccgcatcgtcgcggac
ggcctggcgcagcttgcgggcgacgtgccgacgctgtcggaagaacgaacccacctcgcc
tcgccgccatttctggacagcttcttcctgatcgatccgctcgacggcaccaaggagttc
gtcgccggccgcgacgagttcacggtcaacctcgctctcgtcacccggggcgtgccgctg
ctcggcatcgtcagcgcgcccgcgctcgggttgctctggcgcggcatcgtcggccgcggc
gccgagcgcgtcagattcgacggcgcgaccatcggtgccgccgagccgatccatacccgc
cggctgccgattgcgggcgagccctggatcgcggcggtgagccgctcgcatggcgacccg
aagaccgaggcgttcatcgatggccggcccaatgcggtcagaaagaccgtcggctcggcc
gtgaaattcggccggatcgcggagggcagcgccgacatctatccccgtttcggacccacc
tgtgaatgggacgtcggggccggctgcgcggtggtcaccgccgccggcggccgggtcacc
gacggcaagggcggcgagctccggttcggccagcgtggcgataccggcttcatcatcccg
gacttcatcgcctggggcgacccgcaggcggcaggcagctactga

DBGET integrated database retrieval system