KEGG   Bradyrhizobium sp. S23321: S23_58330Help
Entry
S23_58330         CDS       T01796                                 

Definition
putative inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    S23_58330
Enzymes [BR:brs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     S23_58330
Transfer RNA biogenesis [BR:brs03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    S23_58330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6034972..6035796
Genome map
AA seq 274 aa AA seqDB search
MKRIIDGQAASGLMEPLTALVVKAGEAILAVNRSAMRVDGKQDGSPVTEADLAADRIVAD
GLAQLAGDVPTLSEERTHLASPPFLDSFFLIDPLDGTKEFVAGRDEFTVNLALVTRGVPL
LGIVSAPALGLLWRGIVGRGAERVRFDGATIGAAEPIHTRRLPIAGEPWIAAVSRSHGDP
KTEAFIDGRPNAVRKTVGSAVKFGRIAEGSADIYPRFGPTCEWDVGAGCAVVTAAGGRVT
DGKGGELRFGQRGDTGFIIPDFIAWGDPQAAGSY
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcggatcatcgacggccaagccgcatccggcctgatggagccgctcaccgcgctg
gtggtgaaggcgggcgaagcgatcctcgcggtcaaccgctccgcaatgcgggtcgacggc
aagcaggatggctcgcccgtgaccgaggccgaccttgccgccgaccgcatcgtcgcggac
ggcctggcgcagcttgcgggcgacgtgccgacgctgtcggaagaacgaacccacctcgcc
tcgccgccatttctggacagcttcttcctgatcgatccgctcgacggcaccaaggagttc
gtcgccggccgcgacgagttcacggtcaacctcgctctcgtcacccggggcgtgccgctg
ctcggcatcgtcagcgcgcccgcgctcgggttgctctggcgcggcatcgtcggccgcggc
gccgagcgcgtcagattcgacggcgcgaccatcggtgccgccgagccgatccatacccgc
cggctgccgattgcgggcgagccctggatcgcggcggtgagccgctcgcatggcgacccg
aagaccgaggcgttcatcgatggccggcccaatgcggtcagaaagaccgtcggctcggcc
gtgaaattcggccggatcgcggagggcagcgccgacatctatccccgtttcggacccacc
tgtgaatgggacgtcggggccggctgcgcggtggtcaccgccgccggcggccgggtcacc
gacggcaagggcggcgagctccggttcggccagcgtggcgataccggcttcatcatcccg
gacttcatcgcctggggcgacccgcaggcggcaggcagctactga

DBGET integrated database retrieval system