KEGG   Bradyrhizobium sp. S23321: S23_58590Help
Entry
S23_58590         CDS       T01796                                 

Definition
(RefSeq) pyridoxal-5'-phosphate-dependent protein beta subunit
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    S23_58590
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    S23_58590
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    S23_58590
Enzymes [BR:brs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     S23_58590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6056581..6057708)
Genome map
AA seq 375 aa AA seqDB search
MPAASYIDPRNGQLYPLDQPRWCSDQRTPLLVTPGTGISREDIEPRSRSLWRYRAALPVE
IAKPITLGEGCTPLVQQDWGDLRPFFKLEWFNPTGSFKDRGSAVMLSFLRQIGVDAILED
SSGNGGSSMAGLGAAGRLRVKILAPASTSPAKIAQVRAYGAEVQLVEGPREESEAEAIRQ
SSQTFYASHNWQPLFLEGTKSLAYEIWEDLGFRAPDNVIVPVGAGSSLLGCAFGFRELLK
SGQIAKLPRLFAAQPLNCSPIDASFKAGVDTPVAREVNKTIAEGTAIKAPLRLREIIAAL
RESGGGTVALTEDEIVAALRRLARQGLFAEPTSASAAAALEKLSAIGAIKASETTVAVLT
GTGLKAATTVADLVQ
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccgccagctacatcgatccccgcaacggacagctctatccgctcgaccagccg
cgctggtgctcggaccagcgcacgccgctgctggtgacgccgggaacaggcatctcgcgc
gaggacatcgagccccgctcgcgctcgctctggcgctaccgcgcggcgctgccggtcgag
atcgcaaagccgatcacgctcggcgaaggctgcacgccgctggtccagcaggactggggc
gacctgcgcccgttcttcaagctcgaatggttcaacccgaccggcagcttcaaggaccgc
ggttcggcggtgatgctgtccttcctgcgccagatcggcgtcgacgccattctggaggac
tcctccggcaatggcggctcgtcgatggctgggcttggcgccgccggcagactgcgcgtg
aagattctggcgccggcctcgacatcgccggccaagatcgcgcaggtgcgcgcttacggt
gccgaggtgcagctcgtcgaaggcccgcgggaggagtcggaagccgaggcgatccgccag
tcgagccagaccttctatgccagccacaattggcagcctctttttctggaaggcaccaag
tcgctcgcctatgaaatctgggaagacctcggttttcgcgcgcccgacaacgtcatcgtg
cccgtcggcgccggcagcagtcttttaggctgcgccttcggcttccgcgagttgttgaaa
tcaggccagatcgcaaagctgccgcgcctgttcgcggcgcagccgctgaactgctcgccg
atcgatgcgagcttcaaggccggcgtcgacacgcctgtcgcgcgcgaggtgaacaagacc
atcgccgaaggcaccgccatcaaggctccgctgcgcctgcgcgagatcatcgccgctctg
cgcgagagcggcggcggcaccgttgcgctcaccgaggacgagatcgtcgccgccttgcgt
cgtcttgcgcgccagggccttttcgccgagccgaccagcgccagcgcggccgccgcgctg
gaaaagctctccgccatcggcgccatcaaggcgagcgagaccacggtcgcggtcctcacc
ggcaccggcctgaaggctgcgaccaccgtggccgatctcgtgcagtaa

DBGET integrated database retrieval system