KEGG   Bradyrhizobium sp. S23321: S23_59680Help
Entry
S23_59680         CDS       T01796                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
brs00010  Glycolysis / Gluconeogenesis
brs00620  Pyruvate metabolism
brs00640  Propanoate metabolism
brs00680  Methane metabolism
brs01100  Metabolic pathways
brs01110  Biosynthesis of secondary metabolites
brs01120  Microbial metabolism in diverse environments
brs01130  Biosynthesis of antibiotics
brs01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    S23_59680
   00620 Pyruvate metabolism
    S23_59680
   00640 Propanoate metabolism
    S23_59680
  Energy metabolism
   00680 Methane metabolism
    S23_59680
Enzymes [BR:brs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     S23_59680
Lipid biosynthesis proteins [BR:brs01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   S23_59680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: BAL79157
UniProt: I0GEH0
Position
complement(6169149..6170759)
Genome map
AA seq 536 aa AA seqDB search
MLTEAATYDELYRNFRWDVPARFNMAEACCDRHADGTGRLALVYVDENGTTTRTSFDEVA
EMSRRFANVLKADGLGRGDRVAVFLSQSLELPVAHMAAFRSAMISIPLFALFGEDALEFR
LSNSQAKAIVTDEAGWEKLARIRDRLPDLKNVYVVGQSAPSGTKSFWTAVKAASPDFAQV
DTSADDPALIIYTSGTTGNPKGALHAHRVVLGHLPNVEMCHNFLPRPGDLMWTPADWAWI
GGLVNGLFAFWYHGVPLVGHRARKFEPQAAMQMMAELGVRNVFLPPTALKLMRQAGVKHS
GVKLRSIFTGGESLGGELLGWVRETFGIDAHEVFGQTECNLVIGSNSNLFPIRPGSMGKA
TPGFDVRIVNDKGEEQPRGQRGIIGVRQPCPCTMIEYWRNPEATAKKYAGEFLLTGDLGV
QDEDGYFWYVSREDDVITTAGYRVGPSEIEHTLMKHPSVAMAAVVGIPDPIRTESIKAWI
VLRPGFAPGEALAREIQEFVKVQLAAHEYPRFVAFAETLPMTATGKVLRRELRAKG
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccgaagccgccacctacgacgaactctaccgcaatttccgctgggacgtcccg
gcgcgcttcaacatggcggaggcgtgctgcgaccgccatgccgacgggaccggccgcctc
gcgctggtctatgtcgacgagaacggcactaccacgcgcacttccttcgacgaggtcgcg
gagatgtcgcgccgcttcgccaatgtgctgaaggccgacggcctcgggcgcggcgaccgc
gttgcggtgttcctgtcgcaatcgctggaattgccggtcgcgcacatggcggcgttccgt
tcggcgatgatctcgatcccgctgttcgcattgttcggtgaggacgcgctggaattccgt
ctgtcgaactcgcaggccaaggcgatcgtcaccgacgaagcgggctgggagaagctggca
aggatccgcgatcgcctgccggacctgaagaacgtctatgtcgtcggtcaaagcgcgccg
tctggtacgaaatccttctggactgcagtcaaggccgcatcgcccgacttcgcgcaggtc
gacacttcggccgacgatcccgcgctgatcatctacacctcgggcacgacgggcaatccg
aagggcgcgctgcacgcgcaccgcgtcgtgctcggccatctgccgaatgtggagatgtgt
cacaacttcctgccgcgccccggcgatctcatgtggacgccggcggactgggcctggatc
ggcggcctcgtcaacgggctgttcgcgttctggtatcacggcgttccgctggtcggtcat
cgcgcccgaaaattcgaaccgcaggcggcgatgcagatgatggccgagctcggcgtccgc
aacgtcttcctgccgccgaccgcgctcaagctgatgcggcaggccggcgtgaagcattcc
ggtgtgaaactgcgcagcatttttaccggcggtgaatccctcggcggcgaactgctcggc
tgggtgcgcgagaccttcggcatcgatgcgcatgaagtgttcggccagaccgagtgcaat
ctcgtgatcggcagcaactcgaaccttttcccgatccgcccgggctcgatgggcaaggcg
acaccgggtttcgacgtccgcatcgtcaacgacaagggcgaggaacagccacgcggccag
cgtggcatcatcggcgtgcgccagccatgcccctgcacgatgatcgaatactggcgcaat
cccgaggcgacggcgaagaaatatgccggcgagttcctgctgaccggcgatctcggcgtg
caggacgaggacggctatttctggtacgtcagccgcgaggacgacgtcatcaccaccgcc
ggctaccgtgttggcccgtccgagatcgagcacacgctgatgaagcatccgtcggtggcg
atggctgcggtggtcggcattcccgatccgatccgcaccgaatcgatcaaggcctggatc
gtgctgcgcccgggctttgccccgggcgaggcactcgcgcgcgagatccaggagttcgtg
aaggtgcaactcgccgcacacgaatatccccgcttcgtcgcgttcgccgagaccttgccg
atgacggcgacgggcaaggtgctgcggcgcgagctgcgggcgaagggctag

DBGET integrated database retrieval system