KEGG   Bradyrhizobium sp. S23321: S23_61930Help
Entry
S23_61930         CDS       T01796                                 

Definition
putative Protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
brs  Bradyrhizobium sp. S23321
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6387709..6388593)
Genome map
AA seq 294 aa AA seqDB search
MEDRSAKYRAFYAQLICAAARATDHRIEEAFRTVRREPFVGPGPWSISLGGHPYVVTPDD
DPAFLYQNTLLALDSARGLNIGMPGAHAYWLSGCAVKEGETVIQIGAGSGYYTAILAHLA
GPGGRVHAYEIDERLAGLARENLKDVPHVDVRDRSGIASDLPKADVIYVCAGAAQPATEW
LDALLPGGRLVFPLAPEGMLGGMLMITRPDNGAIWPAKFLGRAQFIGCAGLQNEDAARRL
ADAFAKGWEGVQSLRRDGVPDETCWFAGEGWWLSTAAAPVVTDSIRPHADITQA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggaagatcgttcggcaaaatatcgcgcgttctatgcgcagttgatctgtgccgcggca
agggccacggatcaccgcatcgaggaagccttccgcaccgtcaggcgcgagccattcgtc
gggcccgggccatggtcgatctctctcggcggccacccctatgtggtgacgcccgatgac
gatcccgccttcctctatcagaacacgttgctcgcgctcgatagcgcacgcggcctcaat
ataggcatgcccggcgcgcacgcctattggctcagcggctgcgccgtgaaggaaggcgag
accgtgatccagatcggcgcaggcagcggctattacaccgcgatcctggcgcatctcgcc
ggtcccggcggccgcgtccacgcctatgagatcgacgaacgtctggcggggctcgcacgc
gaaaatctgaaagatgtccctcatgtcgatgtgcgcgatcgctcgggcatcgcgtccgat
ctgcccaaagccgacgtgatctatgtctgcgcgggcgcggcgcaaccggccaccgaatgg
ctcgatgccttgctgcccggcgggcggctggtgtttccgctcgcgcctgagggcatgctc
ggcggcatgctgatgatcacgcgcccggacaatggtgcgatctggccggcgaaattcctt
ggccgcgctcaattcatcggctgcgcgggactacagaatgaggatgccgcccggcgactg
gccgacgcgtttgcaaagggttgggagggagtgcagtcgttgcggagggacggcgttccc
gacgagacctgctggttcgccggtgaaggatggtggctgtccacggcagcggcgccggtc
gttacggattcaatcaggccccacgcagacatcacgcaggcttag

DBGET integrated database retrieval system