KEGG   Bradyrhizobium sp. S23321: S23_63060Help
Entry
S23_63060         CDS       T01796                                 

Gene name
pldB
Definition
lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    S23_63060 (pldB)
Enzymes [BR:brs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     S23_63060 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6546439..6547386)
Genome map
AA seq 315 aa AA seqDB search
MTLVSIPSNPVPENVVSGTIKTPDGVELRFARWAPPAGRKGTVCVFTGRSEQIEKYFETV
RDLRDRGFAVAMIDWRGQGHSSRRLRDPRKGYVRDFSDFEIDVETFVQQVVLPDCPPPFF
ALAHSMGGTVLLRVAHAGKRWFDRMVLSAPMIDLPGRATSLPARALLKTMRLMGMGGRYV
PGGSDQITGLNPFINNPLTSDPVRYARNAAILEEDPTLGLASPTVAWADTAFRAMHTFKG
MHYPSEIRQPILMLAASNDTVVSTAAIEEFAYHLRAGSHLVIAGAKHEILQEQDRYRSQF
WAAFDAFVPGTPLFK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgacgctggtctcgattccgtccaatcccgtgcccgaaaacgtcgtcagcggcaccatc
aagacgcccgacggcgtcgagctgcgctttgcgcgctgggcgccgccggcgggccgcaag
ggcacggtctgcgtgttcaccgggcgcagcgagcagatcgagaaatatttcgagaccgtg
cgtgacctgcgcgaccgcggctttgcggtggcgatgatcgactggcgcgggcagggccat
tcctcgcgccgcctgcgcgatccgcgcaagggctatgtgcgcgacttttccgatttcgag
atcgacgtcgagaccttcgtgcagcaggtggtgctgccggattgcccgccgccctttttc
gcgctcgcccattccatgggtggcaccgtactgctgcgggtggcgcatgccggcaagcgc
tggttcgaccgcatggtgctgtcggcgccaatgatcgacctgcccggccgcgccacctcg
ttgccggcgcgggcgctcctgaagacgatgcgcctgatggggatgggcggccgctatgtc
cccggcggcagcgaccagatcaccgggctcaaccccttcatcaacaatcccctgaccagc
gatcccgtgcgctatgcgcgcaacgccgcaatcctggaggaggatccaacgctcgggctg
gcgtcaccgacggtcgcctgggccgataccgccttccgcgcgatgcacaccttcaagggc
atgcactacccctccgagatacgccagccgatcctgatgctggcggcgtccaacgacacc
gtggtctcgaccgcggcgatcgaggagttcgcctatcacttacgcgccggctcccatctc
gtgatcgccggcgccaagcacgaaatcctccaggagcaggaccgctaccgctcccagttc
tgggccgccttcgacgccttcgtgccgggcacgccgctgttcaagtga

DBGET integrated database retrieval system