KEGG   Bradyrhizobium sp. S23321: S23_65360Help
Entry
S23_65360         CDS       T01796                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:brs01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:brs00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6782631..6783926)
Genome map
AA seq 431 aa AA seqDB search
MPVRLDRSSADFDQRFAAFLAAKREVSADVEAAVRAIVDDVARRGDAALLEATAKFDRLS
LDASGLRVTAAEIEAAVKACDVATLDALKLARDRIETYHRRQLPKDERFTDPLGVELGWR
YTAIESAGLYVPGGTAAYPSSVLMNAVPAKVAGVSRLVMVVPSPDGKLNPLVLAAARLGG
VSEIYRVGGAQAVAALAHGTATIAPVAKIVGPGNAYVAAAKRLVFGKVGIDMIAGPSEVL
VIADETGNADWIAADLLAQAEHDASAQSILITDSARLAADVEKAVAAQLKTLPRAAIASA
SWADFGAIIMVKNMSEAIPLADAIAAEHLEIMTIDPDALAAKIRNAGAVFLGAHTPEAIG
DYVGGSNHVLPTARSARFSSGLSVHDFIKRTSILKCGPDQLRALGPAAMTLGQAEGLDAH
SRSIGLRLNLS
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcccgttcgtctcgaccgcagcagcgccgattttgaccagcgattcgcggccttcctc
gccgccaagcgcgaggtctcggccgacgtcgaggccgccgtgcgggcgatcgtcgacgac
gtggcaaggcgcggggacgccgccctgctcgaggccacggcaaagttcgaccggctatcg
ctggatgcatccggccttcgcgtaaccgccgccgagatcgaggccgcagtgaaggcttgc
gacgtcgcgacactggacgcgctgaagctcgcgcgcgaccgcatcgagacctatcatcgc
cgccagcttccgaaggacgagcgcttcaccgatccgctcggcgtcgagctcggctggcgc
tacacggcgatcgaatccgccggtctctacgtgcccggcggcaccgcggcctatccgtcc
tccgtgctgatgaacgcggtgcctgccaaggtcgccggcgtctcgcgcctggtgatggtg
gtgccgtcgccggacggcaagctcaacccgcttgtgctggccgccgccaggctcggcggc
gtcagcgagatctaccgcgtcggcggcgcgcaggccgtggccgcgctcgcgcacggcacc
gcgacgatcgcgccggttgccaagatcgtcggccccggcaatgcctatgtcgccgctgca
aaacgactggtgttcggcaaggtcggcatcgacatgatcgccggtccctccgaggtgctg
gtgatcgccgacgaaaccggcaatgccgactggatcgccgcggacctcctggcgcaggcc
gagcacgatgccagcgcgcaatcgatcctgatcaccgattccgcgcgccttgccgccgat
gtcgaaaaggccgtcgcggcgcagttgaagacgctgccgcgcgccgcgatcgccagcgcc
tcctgggccgatttcggcgcgatcatcatggtgaagaacatgagcgaggcgatcccgctc
gcggatgcgatcgccgccgagcatctcgagatcatgacgatcgatcccgatgcgctcgcc
gcaaagatccgcaacgccggtgcggtgttcctcggtgcgcatacgcccgaagcgatcggc
gattatgtcggcggctccaaccacgtgctgccgacggcgcgttcggcgcggttctcctca
ggcctgtcggtgcacgacttcatcaagcgcacctccatcctgaaatgcggtccggaccag
ctgcgtgcgctgggcccggccgcgatgacgctcggacaagcggaggggctggatgcccat
tcgcgctcgattggattgcgcctcaacctgtcatga

DBGET integrated database retrieval system