KEGG   Bradyrhizobium sp. S23321: S23_66150Help
Entry
S23_66150         CDS       T01796                                 

Definition
putative endoglucanase 3 precursor
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    S23_66150
Enzymes [BR:brs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     S23_66150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6860361..6861425)
Genome map
AA seq 354 aa AA seqDB search
MPVPQTVAPDRLAALSRGFNADGWINGERSAPPSRELLLQLRKAGMSHVRLPVPAERVML
RFAAKAERDETLRALDTALKQLTALGYSVSVDLHPGERFNRLHKDDPDAALREMKEAWSA
LAGIIRAYPTNRVFAELLNEPDVEAGRWQEEVESLAAFVRQLLPATTLVVGPVNWQRADS
LPQFRPLPDPNVVYAIHFYDPMVFTHQGHWDAQDPLHDIIDLPYPISASDPAVRMLRQDL
QARGAAKALGMLDTAIAIARDKPSVDQWLEPAVAWQQKFARPLIVNEFGVLKAGAPRDSR
LRWLASVTAYARAHCWGWTHWELAQGFGLVDSSTGKPDPGVMRALLGASKPGKR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgtgccgcagaccgttgcgccggacaggctcgccgccttgtcgcgcggtttcaat
gccgacggctggatcaacggtgaacgatccgcgccccccagtcgcgaactgctgctgcag
cttcgcaaggcgggcatgagtcatgtccggctgccggtacccgcggagcgcgtgatgctc
cgctttgccgcaaaggccgaacgcgacgagacgctgcgcgcgctcgacacggcgttgaag
cagctcacggcgctcggctactccgtctcggtcgatctgcatcccggcgagcgcttcaat
cgcctgcacaaggacgatcccgacgccgcgctgcgcgagatgaaggaggcgtggagcgcc
ctcgccggcatcattcgggcctatcccacgaatcgcgtcttcgccgagctgctcaatgag
cccgatgtcgaagcgggcaggtggcaagaggaggtcgaatcgctcgccgccttcgttcgc
caattgcttcccgcgaccacgctggttgtcgggccggtcaactggcagcgggcggactcg
cttccgcaatttcgcccgttgccggatccgaacgtcgtctacgccatccatttctacgat
cccatggtgttcacccatcagggccactgggatgcgcaggatccgctgcacgacatcatc
gatctgccctatccgatcagcgcgagcgatcccgccgtccggatgctccgccaggacttg
caggcgaggggcgcggccaaggcgctcggcatgctcgacacggcgattgcgattgcccgg
gacaagccgagcgtcgatcaatggcttgagcccgcggtcgcgtggcagcagaagtttgcg
cggccgctcatcgtcaacgagttcggcgtgctgaaagcgggcgcgccccgcgacagccgc
ctgcgctggctcgcgtcagtcaccgcctatgccagggcgcattgctggggctggacgcat
tgggagctggcgcagggattcggcctcgtcgacagcagcaccggcaagcccgatcccggc
gtgatgcgggcgctgctgggggcgagcaagccgggcaagcgatga

DBGET integrated database retrieval system