KEGG   Bradyrhizobium sp. S23321: S23_66360Help
Entry
S23_66360         CDS       T01796                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    S23_66360 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    S23_66360 (dapE)
Enzymes [BR:brs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     S23_66360 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6882885..6884051
Genome map
AA seq 388 aa AA seqDB search
MTDALSIARDLIRCPSVTPADAGALGVLEQALTAAGFTCHRVTFSEPGTADVDNLYARIG
TEAPHITFAGHTDVVPPGDESAWSVGAFSGEVKDGFLHGRGAVDMKGGIACSVAAVLEHL
AAHDGKPRADGKGSISFLITGDEEDVSVNGTIKLLKWAAERGEKFDHCVLGEPSNVETLG
DTIKVGRRGSQSGTLVVDGVQGHVAYPHRASNPVPDISRLIVAISDEPLDHGSAQFQASN
LEFTSVDVGNKANNVIPGEARAKFNIRYNDNHTQASLRELVETRLTKACGNRIKARIIWE
PSNSNVFVTKPGPFTELAVSAIEEVTGRKPELSTSGGTSDARFISSYCPVIEFGLVGQTM
HQVDERVPVKDLETLTQVYRGILTRYFG
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatgctctctcgattgcccgcgatctcatccgctgcccctcggtaactccggcc
gatgccggcgcgctgggggtgctcgaacaggcgctcaccgccgccggcttcacgtgccac
cgtgtgaccttctccgagcccggcaccgccgacgtcgacaatctctatgcgcggatcggc
actgaagccccgcacatcacttttgccggccacaccgacgtggtgccacccggcgacgag
agcgcctggagcgtcggggcattctccggcgaggtgaaggacggcttcctgcacggccgc
ggcgcggtcgacatgaagggcggcatcgcctgttcggtcgccgctgtgctggagcatctc
gccgcccatgacggcaagccgcgcgcggacggcaagggctcgatttccttcctgatcacc
ggcgacgaggaagacgtctccgtcaacggcaccatcaagctgctgaaatgggccgcagag
cgcggcgaaaaattcgatcattgcgtgctgggcgaaccctccaatgtcgaaacgctcggc
gacaccatcaaggtcggccgccgcggctcgcaatccggcacgctcgtcgtcgacggcgtg
cagggccatgtcgcctatccgcaccgcgcctccaatccggtgccggacatctcgcgcctg
atcgtggccatcagcgacgagccgctcgaccatggcagcgcgcagttccaggcctccaac
ctcgaattcacctcggtcgacgtcggcaacaaggccaacaacgtcatccccggcgaggcc
cgcgcaaagttcaacatccgctacaacgacaaccacacccaggcgagcctgcgcgagttg
gtcgagacgcggctgacgaaagcctgcggcaatcgcatcaaggcccgcatcatctgggag
ccgtcgaattccaacgtgttcgtcaccaagcccggcccgttcaccgagctcgcggtctcc
gcgatcgaggaggtgacgggccgcaagccggagctgtcgacctcaggcggcacctcggat
gcgcgcttcatctcgagctattgcccggtgatcgagttcggcctggtcggccagaccatg
catcaggtcgacgaacgcgtgccggtgaaggatctggagacgctgacgcaggtgtaccgg
gggatactgacgcggtattttgggtag

DBGET integrated database retrieval system