KEGG   Bradyrhizobium sp. S23321: S23_66430Help
Entry
S23_66430         CDS       T01796                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:brs03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6890235..6890837)
Genome map
AA seq 200 aa AA seqDB search
MGAVAGPEIERLVQLLARLPGLGPRSARRAALHLIKKREALMMPLTSALQVALDKVQVCK
TCGNIDTQNPCTVCTDPRRDPAIIVVVADVADLWALERANATQGRYHVLGATLSPLDGVG
PQDLTIDALVARAHAAEVHEIILALNATVDGQTTAHYITDLLQDANVKVTRLAHGVPVGG
ELDYLDEGTLSAAMRQRTLF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgggcgctgttgcgggtcccgaaatcgagcggctggtccagcttctcgcacggctgccg
ggccttggcccgcgctccgcgcggcgtgcggcattgcatctgatcaagaagcgcgaagcg
ctgatgatgccgctgacctccgccctgcaggtcgcgctcgacaaggtccaggtctgcaag
acctgcggcaacatcgacacgcagaatccctgcacggtctgcaccgatccgcggcgcgat
cccgccatcatcgtcgtcgtcgccgacgtcgccgatctctgggcgctggagcgggccaat
gcgacccaggggcgctaccatgtgctgggcgcgaccttgtcgccgctcgacggcgtcggt
ccgcaggaccttaccatcgacgcgctggtcgcgcgcgcccatgcggccgaggtgcacgaa
atcatcctggcgctgaatgccacggtcgacggccagaccacggcgcattacatcaccgac
ctgcttcaggacgccaacgtaaaagtaacccggctggcgcacggtgtgccggtcggtggc
gagcttgattatctcgacgaaggtacgctatcggccgcgatgcggcagcgaaccttgttc
tag

DBGET integrated database retrieval system