KEGG   Bradyrhizobium sp. S23321: S23_66990Help
Entry
S23_66990         CDS       T01796                                 

Gene name
xylA
Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    S23_66990 (xylA)
   00051 Fructose and mannose metabolism
    S23_66990 (xylA)
Enzymes [BR:brs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     S23_66990 (xylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6945851..6947173)
Genome map
AA seq 440 aa AA seqDB search
MNASAKFFDTSTPVAFAGKDAANTHAFRWYDKDRLVHGRRLEDHLRFAVCYWHSLCWPGG
DPFGGETFLRPWHHGSDAMAMARAKADVAFELFRLLDVPFFTFHDVDVAPEGASLRESVA
NLNVIADLFEEKMASAKVRLLWGTANLFTHRRYMAGAATNPDPEIFTYAAGQVRAALEVT
HRLGGQNYVLWGGREGYETLLNTDLKRELDQLGRFVSLVVEHKHRIGFKGPILIEPKPKE
PTRHQYDFDVATCYGFLERYDLLKDVKLNVEQNHAILAGHSFHHEVALAEALGVFGSLDI
NRGDDLLGWDTDQFAMNVGELALVFHEILNRGGFTSGGLNFDAKIRRQSIDPDDLIHAHV
GSMDACARALLAAADMLDAGVLTTPLATRYEGWAGPEGRAILAGQRSLADLADRALGPGF
DPQPRSGRQEYLESLVNRYV
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcgtcagccaagttcttcgatacaagcacgcctgtcgcctttgccggcaaggat
gcggcaaacacgcatgccttccgctggtacgacaaggaccggctcgtacatggccgcagg
ctcgaggatcatttgcgttttgcggtctgctattggcattcgctgtgctggccgggcggc
gatcccttcggcggcgagacctttttgcggccctggcatcacggctcagatgcgatggca
atggcgcgcgccaaggccgatgtcgcttttgagctgttccgcctgctggacgtgcccttc
ttcacctttcacgatgtcgatgtggcacccgaaggtgcttcgctccgcgaatccgtcgcc
aatctcaacgtgatcgccgatctgttcgaagaaaagatggcctcggcaaaggtccgcctg
ctctggggcaccgccaatttgttcacgcatcgccgctacatggcgggcgccgcgaccaac
ccggaccccgaaatcttcacctatgccgccggccaggttcgcgccgcgctcgaggtgacg
caccggcttggcggccagaattatgtgctgtggggtggccgcgagggttacgagacgctg
ctcaacaccgatctcaagcgcgagctcgaccagcttggccgtttcgtctcgctcgtcgtc
gagcacaagcacagaataggcttcaagggaccgatcctgatcgagcccaagccgaaggag
ccgaccaggcatcaatatgatttcgatgtcgccacgtgctacggcttcctcgaacgctac
gacctcctcaaggacgtcaagctcaacgtcgagcagaaccacgccatcctcgccggccac
tccttccatcacgaggtcgcgctggccgaggcgctcggcgtgttcggctcgctcgacatc
aaccgcggcgacgatctgctcggctgggataccgaccagtttgcgatgaacgtgggcgag
ctggcgctggtgttccacgagatcctgaaccgcggcggcttcacctcgggcgggctgaat
ttcgatgccaagatccgccgccagtcgatcgatcccgacgatctcattcatgcccatgtc
ggttcgatggacgcttgcgcgcgcgccttgctcgccgccgccgacatgctcgatgccggc
gtcctcaccacgccgctcgccacgcgttatgaggggtgggccggtcccgagggccgcgcc
attctcgccggccagcgctcactcgccgatcttgccgatcgtgcgctcggccccggcttc
gacccgcagccgcgctcggggcggcaggaatatctggaatccctggtcaaccgctatgtc
tga

DBGET integrated database retrieval system