KEGG   Bacteroides salanitronis: Bacsa_0026Help
Entry
Bacsa_0026        CDS       T01433                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bsa  Bacteroides salanitronis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bsa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bacsa_0026
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bacsa_0026
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bacsa_0026
Enzymes [BR:bsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bacsa_0026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(29004..30374)
Genome map
AA seq 456 aa AA seqDB search
MSNKQKRFILPEDEIPRFWYNIQADMINKPLPPLNPATKEPLKPEDLYPIFAKELCQQEL
NQTDTWIEIPDEVRDMYKYYRSTPLVRAYGLEKALDTPAHIYFKNESVSPIGSHKLNSAL
AQAYYCKKEGVSNITTETGAGQWGAALSYAANVFGLEAAVYQVKISYEQKPYRRSIMQTF
GAQVTPSPSMSTRAGKDILTKYPNHQGSLGTAISEAVELARTTPNCKYTLGSVLSHVTLH
QTIIGLEAEKQMEMAGEYPDAIIACFGGGSNFGGIAFPFMRHTILEGKKTRYIAAEPASC
PKLTRGKFEYDYGDEAGYTPLLPMYTLGHNFTPANIHAGGLRYHGAGVIVSQLIKDNLME
AVDIQQLDSFKAGCLFAKVEGIIPAPESCHAIAATINEALKCKESGEEKVLLFNLSGHGL
IDMSAYDQYLAGNLTNYSLSDEEINKSLAEVNELNK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgagcaataaacagaaaagattcatcttacccgaagacgaaataccacgcttctggtat
aacattcaggcagatatgataaacaaaccgctgcctcccttaaaccctgctaccaaagaa
ccgctcaaacccgaagacctttaccctatcttcgccaaagaactttgccagcaggaattg
aaccaaacagatacatggatcgagatacccgatgaagtgcgcgacatgtacaaatactac
cggagcaccccgctggtacgtgcatacggactggaaaaagcattagacacccctgcccac
atttatttcaagaatgaaagtgtcagcccaatcggctcgcacaagctgaattcggcactg
gcacaagcctattattgcaaaaaagaaggagtaagcaatatcacaaccgaaacaggagcc
ggacaatggggagcagccctgtcgtatgcagccaacgtattcggactggaagctgccgta
tatcaagtaaaaatcagctacgagcagaaaccataccggcgcagcatcatgcagactttc
ggcgcacaggtgactccttcaccttccatgtcaacccgcgcaggaaaagacatcctgacc
aaataccctaaccaccaaggttcactgggtacagctatttctgaagcagtagaactggca
cgcacgacacctaactgcaaatatactttaggctctgtattaagccatgtcaccctccat
cagaccatcatcggactggaggccgaaaagcaaatggaaatggcaggcgaatatcccgat
gccatcatcgcctgcttcggcggaggttccaacttcggcggcatcgctttcccgttcatg
cggcacaccatcctggaaggaaagaaaacccgatacattgcagccgaaccggcatcatgc
ccaaaactgacacgaggcaaattcgaatacgactatggagacgaagccggatataccccg
ctgcttccgatgtacacattgggacacaattttacccctgccaacatccatgccggaggc
ttgcgttatcacggagctggtgtcatcgtatcgcagctgataaaagacaacctcatggaa
gccgtcgacatccaacaattggattcgttcaaagccggctgccttttcgccaaagtagaa
ggcatcatcccggcaccggaatcatgccacgccatcgctgccaccattaatgaagcattg
aaatgcaaagaaagcggcgaagagaaagtgcttcttttcaacctctccggacacggcttg
atcgacatgagcgcttacgaccaatacttggcaggcaatctcaccaattatagcctgagc
gatgaggaaataaacaagagcctggcagaagtgaatgaactgaataaataa

DBGET integrated database retrieval system