KEGG   Bacteroides salanitronis: Bacsa_0125Help
Entry
Bacsa_0125        CDS       T01433                                 

Definition
glycoside hydrolase family protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bsa  Bacteroides salanitronis
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bsa00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
142809..145163
Genome map
AA seq 784 aa AA seqDB search
MNKWSTIGVSLLLSFGAMAGFQSCSPKTESGTFEAGKGTFLLNGEPFVVKAAELHYPRIP
RAYWEHRIKQCKALGMNTICLYVFWNFHEEKPGEFDFTGQKDLAEFCRLCQKNDMYVILR
PGPYVCAEWEMGGLPWWLLKKKDIRLREDDPYFLERVAIFEKEVANQVAGLTIQKGGPII
MVQVENEYGSYGESKEYVAKIRDIVRGNFGDVTLFQCDWASNFQLNALDDLVWTMNFGTG
ANIDEQFAPLKKVRPDSPLMCSEFWSGWFDKWGANHETRAADDMIAGIDEMLSKGISFSL
YMTHGGTNWGHWAGANSPGFAPDVTSYDYDAPISESGKITPKYEKLRETLAKYMDGKKQA
KVPDDIPTISVPAFEFTEVAPLFANLPEPKSDDTIRTMEEYDQGFGSILYRTTLPKIDRS
ATLTVTEAHDYAQIFIDGKYIGKLDRRNGEKQLDIPACAEGAQLDILVEAMGRINFGRAI
KDFKGITEKVELKNGGRTTELKGWKVYNLEDRYEGYKGLKFEPLKSVKDAQGQRVPGCYR
ATFHVEKPGDTFLNFETWGKGLVYVNGYGIGRIWEIGPQQTLYMPGCWLKEGENEILVFD
IVGPKEARTEGLEEPILNQLLVNKPLTHRNEGEELRLAGETPVLSGSFKAGNGWQEMKFG
KPVSGRYVCIEALNAQDGKDLACIAEMYLLDENGERLSREPWIVKYADSEDVSQVNRSAD
KIFDLQESTYWSTETGSAYPHAVVIDLGAKHTLTAIQYLPRMESNVPGGIKDFKVYVKEG
NFNY
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatggtcaaccattggcgtgtcgcttctgctttcgtttggggcgatggctggc
ttccagtcgtgttcgccaaaaaccgagagtggaacattcgaagcaggaaaggggactttc
ttgctcaacggagagccttttgtggtaaaggcagccgaattgcattacccgcgtattccg
cgtgcctattgggagcatcgcatcaagcaatgtaaggctttgggcatgaacacgatttgc
ctgtatgttttctggaatttccatgaagagaagccgggagagttcgactttaccgggcaa
aaggacttggctgagttttgccgcctgtgccagaagaacgatatgtatgtcatccttcgt
cccggtccgtatgtatgtgccgagtgggaaatgggcggtctgccctggtggcttttaaag
aaaaaagacatccgtttgcgtgaggacgacccgtatttcctggaacgtgtggctatcttc
gagaaggaagttgccaatcaggtggctggattgaccatacagaagggcggtcctattatt
atggtgcaggtagagaatgaatacggttcgtatggcgaaagcaaggaatatgtagcgaag
atacgcgacatcgtgcgcgggaatttcggcgatgtgaccttattccaatgcgactgggca
tccaatttccaactcaatgcattagacgatttggtgtggaccatgaacttcggtacgggt
gcgaatatcgatgagcaattcgctcctttgaagaaggtacgtcccgacagcccgttgatg
tgcagcgagttctggagcggatggttcgacaaatggggagccaatcacgagacccgtgcg
gcagatgatatgattgccggcattgatgaaatgctttcaaagggtatttcgttcagcctt
tacatgactcacggcggtaccaactggggacactgggcaggtgctaactcgcccggattt
gcaccggatgtgacttcgtatgattatgatgcgcctatcagcgaatcgggaaagattacg
ccgaaatacgagaaattgcgtgagaccttggcgaaatatatggacggaaagaagcaggct
aaagtgcccgatgatatcccgactatctccgtaccggctttcgagtttaccgaagtggct
ccgctgttcgctaatctgcccgaaccgaagagcgatgataccatccgcacgatggaagag
tacgatcagggattcggaagcattctttaccgcacaactttgcccaagattgaccgttcg
gctacacttaccgtaaccgaagctcacgattatgcacaaatctttattgacgggaaatat
atcggcaaactggaccgccggaacggggaaaagcaactggatattccggcatgtgccgaa
ggcgcgcaattggatatcttggtggaagccatgggacgtatcaatttcggacgggctatc
aaagactttaaaggaattaccgaaaaggtcgaattgaagaacggaggacgtactaccgaa
ttgaaaggctggaaggtttataacctggaagaccgttacgaagggtataaaggtttgaag
tttgaaccgctgaaatcggtaaaagatgcgcaaggccagcgtgtgccgggttgctaccgg
gctacattccacgtagagaagccgggcgatacgttcttgaactttgaaacatggggcaaa
ggcttggtttatgtaaacggatatggcatcggccgtatttgggaaatcggtcctcagcag
acgctttacatgccgggttgctggctgaaggaaggcgaaaacgaaattcttgtattcgat
atcgttggtccgaaagaagcccgtacggaaggtctggaagagccgatattgaaccagttg
ctggtgaataagccgttgacccatcgcaacgagggtgaagagctccggcttgcgggagaa
accccggtattgagcggaagcttcaaagcgggcaacggatggcaggaaatgaaattcggc
aagccggtttcgggacgttatgtctgcatagaagccttgaatgcgcaagacggaaaagac
ttggcatgtattgccgaaatgtatctgcttgatgaaaacggagaacgtctttcgcgtgaa
ccgtggattgtaaaatatgcggatagcgaagatgtatcgcaggtaaaccgttcggcggat
aagattttcgatttgcaggagtctacttactggagtaccgaaaccggttcggcttatcct
catgcggttgtaattgatttgggagcgaagcataccctgactgcaatccaatatctgccc
cgtatggaaagcaatgtgcccggcggcatcaaggactttaaagtctatgtaaaggaagga
aatttcaattattga

DBGET integrated database retrieval system