KEGG   Bacteroides salanitronis: Bacsa_0307Help
Entry
Bacsa_0307        CDS       T01433                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bsa  Bacteroides salanitronis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bacsa_0307
Enzymes [BR:bsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Bacsa_0307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(357318..359987)
Genome map
AA seq 889 aa AA seqDB search
MIITFRIQYHTTWGESLCVCIDEKTVVELSTADGYCWQGQTDYHPDAPATFITYRYIVRR
ENHNIRQEFGMLPHTLYLSAGDDSCYLVQDNWRDLPSASYRFSSAFCNANTCQPADTIPQ
ISCNTRIVFRVLCPLNKKKEGVLGITGNCNVLGNWGKTALLCMFEIQPNVWQLTLDAATL
PPSFEYKYAIVNPENGTVIEWEAHDNRRMTPPSLQPGETYIAPEEEIFFASEKYKVAGSA
IPVFSLRSEGSYGVGDFGDLKTFIRWAADTHQHAVQVLPINDTTMTGTWTDSYPYSSISI
YAFHPMYVDLRQLPSLQDKEAAATFEQKRTELNALPQVDYEAVNQWKRAYLKAVFQQEQE
SILSSEGYQAFFQENAEWLRPYAAFCYLRDHFHTPDFHQWQAYSTYQPEFAEQLCAPENE
AYPETSFHCFVQYLLHIQLLDACNYGREQGVIVKGDIPIGISRTSVEAWIEPYYFNMNGQ
AGAPPDAFSTKGQNWGMPTYNWKVMEKDNYQWWQRRFRKMADYFTAYRIDHILGFFRIWE
IPTHSVHGLLGQFVPALPMSAEEIESYGLHFQKEFMTRPFINDAMLDSMFGEKSQEVRNT
FVQHSHHDIYTLRPEFDTQRKIESYFARQENPDNDLKEGLYALVSNVLFIPDRDNPEMYH
PRIAVQNDFIYTRLSQQEKDAFNRLYNDYYYRRHNEFWYQEAMKKLPILTQSTSMLVCGE
DLGMVPDCVPWVMEQLQILSLEIQRMPKNPEDEFGHVYAYPFRSVCTIGTHDMSTFRGWW
EEDRDVASRFFYHELGHWGELPEHAPGWLCEDVIRRHLYSPSMLCILTWQDWTSMDETLR
NPDIAIERINVPANPKHYWRWRMHMSLESLMKQDAFNDKIRRMIDESGR
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgattataacttttcgaatccagtatcacaccacatggggtgaaagtctatgtgtctgc
attgatgaaaaaaccgttgtagaattgtctactgcagacggttattgttggcaaggacaa
accgactatcatccggacgctcctgctacatttatcacgtaccgttatatagtgcgccgc
gaaaatcataacatccggcaagaattcggcatgcttcctcatacgctctatctgtctgct
ggggatgacagctgctatttggtgcaagacaattggcgcgaccttccatcggcatcctac
cggttcagttcagccttttgcaatgcgaacacatgccagccggcagacacaatacctcaa
atttcatgcaacacacgcatcgttttccgtgtcctttgtcctctaaacaaaaagaaggaa
ggagtactgggcattacaggcaactgcaatgtgttaggcaactggggaaaaacagcttta
ttgtgtatgttcgaaattcagcccaacgtatggcaactgacattggatgcagcaacacta
cctcccagcttcgaatacaaatatgcaattgtcaatccggaaaacggaacggtcattgaa
tgggaagcgcatgacaaccgtcgtatgactcccccatccctgcaacccggggaaacctat
atcgcaccggaagaagagatattcttcgccagcgaaaaatacaaagtagcaggaagcgct
atccctgtattctccctccgctcggaaggcagctatggtgtaggcgacttcggcgactta
aagacattcatccgctgggcagccgatacacaccaacatgcagtacaggtacttccgatt
aacgatacgaccatgacaggcacatggaccgactcttatccgtacagcagcatttcgatt
tacgcatttcatcccatgtatgtcgacctgcgccagcttccttccttgcaagacaaagaa
gcagccgcaacgttcgaacaaaaacgaaccgagcttaatgccctgccccaggttgactat
gaagccgttaaccagtggaagcgtgcttatctgaaagccgtattccagcaagagcaagaa
agcattctttcttctgaaggctatcaggctttctttcaggaaaatgccgaatggctacgt
ccatacgccgctttctgctatttgcgcgaccatttccatacccccgacttccaccaatgg
caagcatacagcacataccagcctgaatttgccgagcaattatgtgcgcctgagaatgaa
gcttatcccgagacctcgttccactgcttcgttcagtacctgcttcatatccaactgctt
gatgcatgcaactacgggcgcgagcaaggtgtcatcgtcaaaggagacattcctatcggc
atcagccgcaccagcgtagaagcctggatagagccatattatttcaacatgaacggacaa
gccggcgcaccgcccgatgctttttctaccaaaggacagaactggggtatgccgacctat
aactggaaggtcatggaaaaagacaactaccaatggtggcaacgccgtttccgtaaaatg
gctgactattttaccgcttaccgtatcgaccatatcttgggattcttccgcatttgggaa
atcccgacccattccgtacacgggcttttgggacagtttgtacctgcattgcccatgagc
gcagaagaaatcgaaagctacggactgcatttccagaaagaattcatgacccgtccgttc
attaacgacgccatgctcgacagcatgtttggagaaaaaagtcaggaagtccggaatacc
ttcgtgcaacattcacaccacgatatctataccctgcgtccagagtttgacacccaacgg
aaaatagagagctactttgcccggcaggaaaatccggataacgacctgaaagaggggctg
tatgcattggtcagcaacgtattgtttataccagaccgcgacaatccggaaatgtaccac
ccgcgtatcgccgtacaaaacgatttcatctatacccggttgagccaacaggagaaagat
gctttcaaccgtctgtacaacgattattattaccgccgccacaacgaattctggtatcag
gaagccatgaaaaagctgcctatccttacacaatccacctccatgctggtgtgtggcgaa
gatttaggtatggttcccgactgtgtgccctgggttatggaacagcttcagattctttcg
ctcgaaatccaacggatgcccaagaatccggaagacgagttcggacatgtatatgcctat
ccgttccggtcggtctgcaccatcggcacacacgacatgtcaaccttccggggctggtgg
gaagaagaccgggacgtagcctcgcgcttcttctatcatgaactgggacattggggcgaa
ctgcccgaacatgcaccgggctggctctgcgaagacgttatccgccggcatctgtacagc
ccttccatgctgtgcatcctgacgtggcaagactggacatctatggacgaaaccttgcgc
aatcccgacattgccatcgaacggataaacgtacctgccaacccgaaacattactggcgc
tggcgcatgcacatgtccttggaaagcctgatgaaacaagacgcattcaatgacaaaatc
cgccggatgatagacgaaagcggaagataa

DBGET integrated database retrieval system