KEGG   Bacteroides salanitronis: Bacsa_0615Help
Entry
Bacsa_0615        CDS       T01433                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bsa  Bacteroides salanitronis
Pathway
bsa00500  Starch and sucrose metabolism
bsa01100  Metabolic pathways
bsa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bacsa_0615
Enzymes [BR:bsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Bacsa_0615
Exosome [BR:bsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bacsa_0615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: ADY35211
JGI: Bacsa_0615
UniProt: F0R0H5
Position
complement(661155..663164)
Genome map
AA seq 669 aa AA seqDB search
MDEVLNIIKNDPWLAPYQDAITGRHQHAIDKEKELAGKKTLSDFATGHLYFGLHHTDKGW
TFREWAPNATAIYLIGDFNDWTESPKFKLKKVKNSGNWEINLPEKAMKHGDLYKLKVYWE
GGCGERIPAWATRVVQDDNTKIFSAQVWNPSKPYKFKKKVFTPNVSPLMIYECHIGMAQD
AEKVGTYNEFRENILPRVVKDGYNCIQIMAIQEHPYYGSFGYHVSSFFAPSSRFGTPDEL
KQLIDTAHQMGLAVIMDIVHSHAVKNEVEGLGNFAGDPCQYFYQGDRREHPAWDSLCFDY
GKNEVLHFLLSNCKYWLEEFHFDGFRFDGVTSMLYYSHGLGEAFCSYEDYFNGHQDDNAI
CYLTLANKLIHQVNPRAITIAEEVSGMPGLAAPFDDGGYGFDYRMAMNIPDYWIKIIKER
KDEDWKPSSMFWEVTNRRKDEKTISYCESHDQALVGDKTIIFRLIDADMYWHFRKGDENG
VAERGIALHKMIRLLTASTINGGYLNFMGNEFGHPEWIDFPREGNGWSYKYARRQWHLVD
DPSLCYQYLGDFDSAMVHLIESVKNIQKTDVIEVWHNDGDQVLAYRRKDLVFVFNFNPTR
SFTDYGFLVPRGEYHVVLNTDNKAFGGFGFSDDSIPHFTCADPLYAKDKKEWLKLYIPAR
SAVVLKRQK
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagtattgaatatcattaagaatgacccgtggttggctccatatcaagacgcg
attaccggcaggcaccaacatgcgatagataaggaaaaagaactggcaggaaagaaaacg
ttgtcggactttgcgaccggacatctttatttcggtttgcatcatacggacaaaggatgg
acattccgtgaatgggcgcccaatgcaactgcaatttatttaattggtgattttaatgac
tggacagaatcacctaagtttaagctgaaaaaagtaaaaaatagcgggaattgggaaatc
aatcttccggagaaagccatgaagcatggcgacctgtacaaattaaaggtgtattgggaa
ggcggatgcggagaacgtattccggcatgggctacccgtgtagttcaggatgacaatacc
aagatattcagcgcacaagtctggaatccaagcaaaccgtataaatttaagaaaaaagta
tttacaccgaatgtaagtcccttgatgatttatgaatgccatatcggcatggctcaagat
gcagaaaaagtcggtacctataatgaattccgtgaaaacatcttgccgcgtgtagtaaaa
gacggttataattgcattcagattatggctattcaggaacatccgtattatggaagtttc
ggctatcacgtatccagcttttttgctccttcttcacgatttggcacacccgatgaattg
aaacagcttattgatacagcacatcaaatgggacttgccgttatcatggatattgtgcat
tcacatgccgtaaaaaatgaagtggagggattgggcaactttgcaggagacccttgccag
tatttctatcaaggtgaccgccgtgaacatccggcatgggattctctttgtttcgattac
ggaaaaaatgaagtgctccatttcttgctttcgaactgcaagtactggttggaggagttc
cattttgacggtttccgttttgacggagtcacttcaatgctttattacagtcatgggtta
ggcgaggctttctgcagctatgaagactatttcaatgggcatcaagacgacaatgccatt
tgttatttgaccttggctaataaactgattcatcaggtcaatccgcgtgccataacaata
gctgaagaagtgtcaggtatgccaggattggctgctccttttgatgacggaggatatggt
ttcgattaccgtatggctatgaatattccggattattggattaagataatcaaggaacgc
aaggatgaagactggaaaccgtccagtatgttctgggaagtgaccaatcggagaaaagac
gaaaagactatttcgtattgtgaaagccatgaccaggcattggtaggagacaagacgatt
attttccgtttgatcgatgcggatatgtattggcatttccgtaaaggtgatgagaatggt
gtcgcagaacgaggcatagctttgcataagatgattcgcttgctgaccgcttctaccatc
aatggaggctatctgaactttatgggaaatgaattcggacatcccgaatggattgatttt
ccgcgcgaaggtaacggctggtcgtacaagtatgctcgccgtcaatggcatttggtagac
gatccttctttgtgttatcaatacttaggagatttcgattccgctatggttcatttgata
gaaagtgtcaagaatattcaaaaaaccgatgtaatagaagtttggcacaacgatggcgac
caagtattggcataccgccggaaggatttagtgtttgtatttaactttaacccgacacgt
tcgtttaccgactacggatttttagttccacgtggggaatatcatgttgtgttgaatact
gataataaagcgtttggcggattcggattttcagacgattcgatacctcattttacttgt
gccgacccgttgtatgcaaaagataagaaagaatggcttaaactttacatcccggcacgt
tcggctgtagtattgaaacgtcagaaatag

DBGET integrated database retrieval system