KEGG   Bacteroides salanitronis: Bacsa_0615Help
Entry
Bacsa_0615        CDS       T01433                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bsa  Bacteroides salanitronis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bsa00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(661155..663164)
Genome map
AA seq 669 aa AA seqDB search
MDEVLNIIKNDPWLAPYQDAITGRHQHAIDKEKELAGKKTLSDFATGHLYFGLHHTDKGW
TFREWAPNATAIYLIGDFNDWTESPKFKLKKVKNSGNWEINLPEKAMKHGDLYKLKVYWE
GGCGERIPAWATRVVQDDNTKIFSAQVWNPSKPYKFKKKVFTPNVSPLMIYECHIGMAQD
AEKVGTYNEFRENILPRVVKDGYNCIQIMAIQEHPYYGSFGYHVSSFFAPSSRFGTPDEL
KQLIDTAHQMGLAVIMDIVHSHAVKNEVEGLGNFAGDPCQYFYQGDRREHPAWDSLCFDY
GKNEVLHFLLSNCKYWLEEFHFDGFRFDGVTSMLYYSHGLGEAFCSYEDYFNGHQDDNAI
CYLTLANKLIHQVNPRAITIAEEVSGMPGLAAPFDDGGYGFDYRMAMNIPDYWIKIIKER
KDEDWKPSSMFWEVTNRRKDEKTISYCESHDQALVGDKTIIFRLIDADMYWHFRKGDENG
VAERGIALHKMIRLLTASTINGGYLNFMGNEFGHPEWIDFPREGNGWSYKYARRQWHLVD
DPSLCYQYLGDFDSAMVHLIESVKNIQKTDVIEVWHNDGDQVLAYRRKDLVFVFNFNPTR
SFTDYGFLVPRGEYHVVLNTDNKAFGGFGFSDDSIPHFTCADPLYAKDKKEWLKLYIPAR
SAVVLKRQK
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagtattgaatatcattaagaatgacccgtggttggctccatatcaagacgcg
attaccggcaggcaccaacatgcgatagataaggaaaaagaactggcaggaaagaaaacg
ttgtcggactttgcgaccggacatctttatttcggtttgcatcatacggacaaaggatgg
acattccgtgaatgggcgcccaatgcaactgcaatttatttaattggtgattttaatgac
tggacagaatcacctaagtttaagctgaaaaaagtaaaaaatagcgggaattgggaaatc
aatcttccggagaaagccatgaagcatggcgacctgtacaaattaaaggtgtattgggaa
ggcggatgcggagaacgtattccggcatgggctacccgtgtagttcaggatgacaatacc
aagatattcagcgcacaagtctggaatccaagcaaaccgtataaatttaagaaaaaagta
tttacaccgaatgtaagtcccttgatgatttatgaatgccatatcggcatggctcaagat
gcagaaaaagtcggtacctataatgaattccgtgaaaacatcttgccgcgtgtagtaaaa
gacggttataattgcattcagattatggctattcaggaacatccgtattatggaagtttc
ggctatcacgtatccagcttttttgctccttcttcacgatttggcacacccgatgaattg
aaacagcttattgatacagcacatcaaatgggacttgccgttatcatggatattgtgcat
tcacatgccgtaaaaaatgaagtggagggattgggcaactttgcaggagacccttgccag
tatttctatcaaggtgaccgccgtgaacatccggcatgggattctctttgtttcgattac
ggaaaaaatgaagtgctccatttcttgctttcgaactgcaagtactggttggaggagttc
cattttgacggtttccgttttgacggagtcacttcaatgctttattacagtcatgggtta
ggcgaggctttctgcagctatgaagactatttcaatgggcatcaagacgacaatgccatt
tgttatttgaccttggctaataaactgattcatcaggtcaatccgcgtgccataacaata
gctgaagaagtgtcaggtatgccaggattggctgctccttttgatgacggaggatatggt
ttcgattaccgtatggctatgaatattccggattattggattaagataatcaaggaacgc
aaggatgaagactggaaaccgtccagtatgttctgggaagtgaccaatcggagaaaagac
gaaaagactatttcgtattgtgaaagccatgaccaggcattggtaggagacaagacgatt
attttccgtttgatcgatgcggatatgtattggcatttccgtaaaggtgatgagaatggt
gtcgcagaacgaggcatagctttgcataagatgattcgcttgctgaccgcttctaccatc
aatggaggctatctgaactttatgggaaatgaattcggacatcccgaatggattgatttt
ccgcgcgaaggtaacggctggtcgtacaagtatgctcgccgtcaatggcatttggtagac
gatccttctttgtgttatcaatacttaggagatttcgattccgctatggttcatttgata
gaaagtgtcaagaatattcaaaaaaccgatgtaatagaagtttggcacaacgatggcgac
caagtattggcataccgccggaaggatttagtgtttgtatttaactttaacccgacacgt
tcgtttaccgactacggatttttagttccacgtggggaatatcatgttgtgttgaatact
gataataaagcgtttggcggattcggattttcagacgattcgatacctcattttacttgt
gccgacccgttgtatgcaaaagataagaaagaatggcttaaactttacatcccggcacgt
tcggctgtagtattgaaacgtcagaaatag

DBGET integrated database retrieval system