KEGG   Bacteroides salanitronis: Bacsa_0622Help
Entry
Bacsa_0622        CDS       T01433                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bsa  Bacteroides salanitronis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bacsa_0622
Enzymes [BR:bsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Bacsa_0622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
667906..668286
Genome map
AA seq 126 aa AA seqDB search
MKNMHRCILCIGSNYRAETFMELAEMLLNRRFPSIRWGKMIKTLPEGTTCPDPYFNRAAS
FDTAWDADALRNYFKSIEKACGRTLLSKQMGIIPLDIDLLMMDNTVLKPEDMQKMYVRQA
LQGFET
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatgcatcgatgcattctttgcatcgggtcgaattatcgggcggaaactttt
atggaactggcagaaatgctgctcaaccggcgtttcccttccatccggtggggaaagatg
ataaagactttacccgaagggacaacatgtcctgacccttacttcaatcgtgccgcctca
ttcgatacggcatgggatgccgatgctttgcggaattattttaaaagcattgaaaaagcc
tgcgggcgtacattgctgagtaagcagatgggcatcatccctcttgacattgacttgctg
atgatggacaatacggtgcttaagccggaagacatgcaaaaaatgtatgtacgtcaagcg
ttgcaagggtttgaaacataa

DBGET integrated database retrieval system