KEGG   Bacteroides salanitronis: Bacsa_0688Help
Entry
Bacsa_0688        CDS       T01433                                 

Definition
fructose-1,6-bisphosphatase class 3 (EC:3.1.3.11)
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
bsa  Bacteroides salanitronis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bacsa_0688
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bacsa_0688
   00030 Pentose phosphate pathway
    Bacsa_0688
   00051 Fructose and mannose metabolism
    Bacsa_0688
  Energy metabolism
   00680 Methane metabolism
    Bacsa_0688
Enzymes [BR:bsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Bacsa_0688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
740719..742716
Genome map
AA seq 665 aa AA seqDB search
MKPYNQITAEIIQEDMRYLELLSHSFPTIAAASTEIINLEAILNLPKGTEHFLADLHGEY
EAFQHVLRNASGAIKRKVNEIFGNTLREAEKKELCTLIYYPEQKLQLVKETENELEDWYV
ITLNQLVKVCQNVSSKYTRSKVRKALPEEFSYIIQELLHESSMDPNKQAYINVIISTIID
THRADDFIVALCNLIQRLTIDTLHILGDIFDRGPGPHIIMDTLCDYHNFDIQWGNHDILW
MGAASGNDCSIANVLRLAMRYGNLSVLEDGYGINLLPLATFAMETYANDPCTLFGPRIDE
ATNTDNQKTIRLIAQMHKAISIIQFKLEAGIIRRRPEFEMEGRMLLHRIDFDKHTVRIDG
KEYPLRDTFFPTVDPKDPYRLSAEEQDIVQKLHNSFVGSEKLRKHMKCLFRYGCMYNVCN
SNLLFHASMPLNADGTLKEIEILGKKYKGQSLLKRVGQLIRTAYFDENDSPEKAFALDYM
WYLWCGKDSPAFDKDKMATFERYFVSDKETHVETKGYYYQLRDREDICDMILDEFGVEGE
HRHIINGHVPVKAVKGEKPIKANGKLMVIDGGFSKAYQPETGIAGYTLVYHSRGFQLVQH
EPFTSTQRAIEEGLDIKSTTQIVEMSAKRMMVKDTDKGKELEVQIEDLKKLLAGYRTGLI
KEKAD
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccctacaaccaaatcaccgcggaaataattcaggaagacatgcgctaccttgaa
ttgctttcacacagcttcccgaccatagccgccgccagcaccgaaatcatcaacctggaa
gcgatactcaacttgcccaaaggtaccgaacacttccttgccgacctgcacggagaatac
gaggctttccagcacgtgttgcgaaacgcttcgggagccatcaagcggaaggtgaacgaa
atattcggaaacaccttgcgcgaagcggaaaaaaaagaactctgcaccctcatctattat
cccgaacaaaagctgcaactggtgaaggaaacggaaaacgaattggaagactggtatgtc
atcaccctgaaccagctggtaaaggtatgccagaacgtttcgtcgaaatacacccggtcg
aaagtgcggaaagcgctgcccgaagagttttcatacattatccaagaactcctgcatgaa
agcagcatggatcctaacaagcaagcgtacatcaatgtcatcatcagcaccatcatcgat
acgcaccgcgccgatgatttcatcgtggcactatgtaacctgatacaacgcctcaccatc
gatacgctccatatcctgggcgacatcttcgaccgcggtcccggtccgcacatcatcatg
gacaccctgtgcgattaccataacttcgacatccaatggggaaaccacgacatcctgtgg
atgggagcggcatctggaaacgattgcagcatcgccaacgtattacgccttgccatgcgc
tacggaaatctttccgtgctggaagacggatatggcatcaacctcctgccccttgccaca
tttgccatggagacttatgccaacgacccttgcacactcttcggaccgcgcatcgacgaa
gccaccaatacagacaaccagaaaaccatacgcctcattgcccagatgcacaaagccatc
agcatcatccagttcaagctcgaagccggaatcatccgccgccgccccgaattcgaaatg
gaaggaagaatgctgctgcaccgcatcgacttcgacaagcatacggtccggatagacggg
aaggaataccccttgcgcgataccttcttccctaccgtagaccccaaagacccttaccgc
ctgagtgccgaagagcaagacatcgtgcagaaactgcacaattcgtttgtcggaagcgag
aaactgcgcaaacacatgaaatgccttttccgttacggatgcatgtacaacgtatgcaac
tccaacctgctcttccatgcttccatgccgcttaacgcagacggcacactgaaagaaata
gagattctgggcaaaaaatacaaagggcaatcattattgaaacgggtaggccagctaatc
cgtaccgcctatttcgacgaaaacgacagccccgagaaagccttcgccctggattatatg
tggtacctgtggtgcggaaaagactcgcctgccttcgacaaggacaagatggcaactttc
gaacggtatttcgtaagcgacaaggaaacccatgtggaaacaaaagggtattactaccag
ctacgtgaccgtgaagacatctgcgacatgatactggatgagttcggcgtagaaggcgaa
caccgccacatcatcaacggacacgtgcccgtaaaagccgtaaaaggcgaaaagccgatt
aaggcgaacggcaaactcatggtgatagacggaggattctcgaaagcttaccagcccgaa
accggcatcgcaggctatacgctggtctatcattcgcgcggcttccagctggttcagcac
gaaccgttcacctccacccagcgcgccatcgaagaagggcttgacatcaagtcgaccacc
caaatcgtagaaatgagcgccaaacgcatgatggtgaaagacactgataaaggaaaagaa
ctggaagtccaaatcgaagacctcaagaaactgctggcaggataccgcacagggcttatc
aaggaaaaagcggactga

DBGET integrated database retrieval system