KEGG   Bacteroides salanitronis: Bacsa_0918Help
Entry
Bacsa_0918        CDS       T01433                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
bsa  Bacteroides salanitronis
Pathway
bsa00010  Glycolysis / Gluconeogenesis
bsa00052  Galactose metabolism
bsa01100  Metabolic pathways
bsa01110  Biosynthesis of secondary metabolites
bsa01120  Microbial metabolism in diverse environments
bsa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bacsa_0918
   00052 Galactose metabolism
    Bacsa_0918
Enzymes [BR:bsa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Bacsa_0918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADY35510
JGI: Bacsa_0918
UniProt: F0R3A1
Position
1053654..1054748
Genome map
AA seq 364 aa AA seqDB search
MINTFYYENNLCGLKRSDFQRTIDGKDVDLFILKNDNGAEMAITNYGGALLAIMVPDKNG
KLANVIQGHDTLDGVIHSPEAFLSTLIGRYGNRIAKGKFQLGGEEYQLAINNGPNSLHGG
PTGFHARVWDAEQTSKQSVTLSYLSQDGEEGFPGNLHVQVIYTFTNQNEFILTYTATTDR
TTLVNLTHHAFFSLSGIANPTPSVENNILTINADFYTPIDEVSITTGEILKVADTPMDFR
TPHTVGSRINEPFQQLINGSGYDHNYVLNKQEAGTLTFAAKCVEPQSGRSLEVFTTEPGV
QVYTANWQSGFSGWHGATFPARSAICFEAQHFPDTPNKGHFPSAVLNPGETYHQVTVYKF
GIEN
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgattaacacattctattatgaaaacaatctctgcggactgaaacgcagcgattttcaa
cgtaccattgacggtaaagacgttgacttgttcattctgaaaaatgataatggtgccgaa
atggcaatcacaaactatggaggtgccttattggctattatggtaccggataagaacggg
aaacttgccaatgttatccaaggacatgacacgttagacggtgtcatccatagtccggaa
gctttcttaagtacgttaatcggacggtatggaaaccgtatagccaaaggcaaattccaa
ttgggaggagaagaataccaacttgccattaacaatggtccgaattcactccatggaggt
cctacgggatttcatgctcgcgtatgggacgcagaacaaaccagcaagcaaagtgtcacg
ctcagctatttatcgcaagacggcgaagagggattccctggaaacctccacgtacaagtg
atttacactttcaccaaccaaaacgaatttatcctgacttatacggcaacaaccgaccgc
acgacattagtcaaccttacccatcatgctttcttcagcctttcgggcattgccaatccg
actccaagcgtggaaaacaacattcttactatcaatgcagacttttatactccgatagat
gaagtatctatcacaacaggagaaatcctgaaagtagcggatactcccatggatttccgt
actccacatacagtaggaagccgcatcaacgaacctttccaacagttaatcaacggaagc
ggatacgaccacaattatgtacttaacaaacaagaagcgggtacattgactttcgccgcc
aaatgcgtagaacctcaaagcggacgttcacttgaagtatttactacagaaccgggcgta
caagtatatacagccaattggcaaagtggtttcagcggatggcatggtgccacattccct
gcacgcagtgccatttgttttgaagcacaacatttccccgacacaccgaacaagggacat
ttcccctcggctgttctgaatccaggcgaaacctatcaccaggtgaccgtatataaattc
ggcatagaaaactaa

DBGET integrated database retrieval system