KEGG   Bacteroides salanitronis: Bacsa_1026Help
Entry
Bacsa_1026        CDS       T01433                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
bsa  Bacteroides salanitronis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bsa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bacsa_1026
DNA repair and recombination proteins [BR:bsa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Bacsa_1026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1173485..1174105
Genome map
AA seq 206 aa AA seqDB search
MNQQYPSALLEKAVDEFAKLPGIGRKTAMRLVLYLLRQDTQAVESFGNALIRLKHEVKYC
KVCHNISDTDVCQICSNPSRDASTICVVENIRDVMAIENTQQYRGLYHVLGGVISPMDGI
GPSDLQIESLVERVKAGTVSEVILALSSTMEGDTTNFYIFRKLAPYNVKLTIIARGISIG
DELEYTDEVTLGRSIANRIVFTGTTI
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaacaatatccgtccgcattactcgaaaaggcagtagacgaatttgccaagctg
cccggcatcggccgaaagaccgccatgaggctggtgctctacctgcttcggcaagacacg
caggcagtggaatcgttcggcaatgcgctcatccggctgaaacatgaagtgaagtattgc
aaggtgtgccacaacatttcggacacggacgtctgccagatttgctccaatccctcgcgc
gatgcctcgaccatctgcgtggtagaaaacatccgcgacgtaatggcaatcgaaaacacc
cagcaataccgcggactataccacgtgctgggcggagtcatctcgccgatggacggcatc
ggtccctcggacctgcagatagaaagcctggtggaacgggtgaaggcaggcaccgtgtcg
gaagtcatcctggcgctcagctcgaccatggagggcgacacaaccaatttttacatcttc
cgcaaactggcaccctacaacgtgaaactgaccatcatcgcccggggcatctccatcggc
gacgagctggaatataccgatgaggtcacgctgggacgctccatcgccaaccggattgtg
ttcacgggcaccacgatttga

DBGET integrated database retrieval system