KEGG   Bacteroides salanitronis: Bacsa_1378Help
Entry
Bacsa_1378        CDS       T01433                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bsa  Bacteroides salanitronis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bacsa_1378
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bacsa_1378
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Bacsa_1378
Enzymes [BR:bsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Bacsa_1378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1538366..1539667)
Genome map
AA seq 433 aa AA seqDB search
MKYYSTNKQASDATLEEAVVRGLAGDKGLYMPREIKPLPASFYDEIENLSFQEIAYRVAD
AFFGEDVPADVLKQIVYDTLSFDAPVVKVKDNIYSLELFHGPTLAFKDVGGRFMARLLGY
FIRKEGKKQVNVLVATSGDTGSAVANGFLGVEGIRVYVLYPKGKVSEIQEKQFTTLGQNI
TAIEVDGTFDDCQALVKNAFMDEELKAHMQLTSANSINVARFLPQAFYYFYAYAQMKKQG
KADNLVICVPSGNFGNITAGLFGKRMGLPVKRFIAANNRNDIFYQYLKTGVYTPRPSVAT
IANAMDVGDPSNFARILDLYGGSHEAISGEISGETYTDEQIRETVQKAYEETGYLLDPHG
ACGYRALAEGLKPGETGVFLETAHPAKFLQTVEAIIGTKVDIPEKLQAFMRGTKQSVPMP
KDFASFKAYLMKQ
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattacagtaccaataagcaggcttccgacgctacactggaagaagccgtagtg
cgcggactggcaggtgacaaagggctttacatgccccgcgaaatcaagcctttgcccgca
tcgttttacgatgagatagaaaacctttcgtttcaggaaatcgcttaccgcgtggcggac
gctttcttcggagaagatgtgccggcggatgtcttgaagcagattgtatatgacaccttg
agctttgatgcgccggtggtgaaggtgaaagacaatatctattcgctggagctcttccac
gggcctacgctggcgttcaaggacgtgggcggacgctttatggcacgcctcttgggctat
ttcatccgcaaggaaggaaagaagcaggtcaatgtactggtagctacgtcgggcgatacg
ggaagtgccgtggcaaacggtttcctgggtgtggaaggcattcgtgtgtatgtgctttac
ccgaaagggaaggtgagcgagatacaggaaaagcagttcaccacgctggggcagaacatc
accgccattgaggtggacggcacgttcgacgattgtcaggcactggtgaagaacgcgttt
atggacgaagagctgaaggcgcacatgcagctgacctctgccaattccatcaatgtggcg
cgcttcttgcctcaagctttctattatttttacgcttatgcccagatgaagaagcagggc
aaggcggacaatctggtcatctgcgtgcccagcgggaacttcggaaacattacggcaggg
cttttcggcaaacggatggggcttccggtaaaacgctttatcgccgccaataaccgcaat
gatattttctatcaatacttgaagacgggtgtctatacgccgcgtccttcggtagcgacc
attgccaatgccatggatgtgggcgaccccagcaacttcgcccgtatcctcgacttatac
ggaggaagccacgaggctatttccggcgaaatcagtggcgagacttataccgatgagcag
attcgcgaaaccgtgcagaaggcttacgaggaaaccggatacctgctcgaccctcacggg
gcgtgcggctatcgtgcgctggcggaaggcttgaagccgggcgaaacgggagtgttcctc
gaaacagcccatccggcaaagttcttgcagacggtggaagccattatcggaaccaaggtg
gatatccccgaaaagcttcaggcgtttatgcgcggcacgaagcaaagcgtcccgatgccg
aaagacttcgcttcattcaaggcatacttgatgaaacagtaa

DBGET integrated database retrieval system