KEGG   Bacteroides salanitronis: Bacsa_1378Help
Entry
Bacsa_1378        CDS       T01433                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bsa  Bacteroides salanitronis
Pathway
bsa00260  Glycine, serine and threonine metabolism
bsa00750  Vitamin B6 metabolism
bsa01100  Metabolic pathways
bsa01110  Biosynthesis of secondary metabolites
bsa01120  Microbial metabolism in diverse environments
bsa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bacsa_1378
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Bacsa_1378
Enzymes [BR:bsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Bacsa_1378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N Galanin
Motif
Other DBs
NCBI-ProteinID: ADY35950
JGI: Bacsa_1378
UniProt: F0R808
Position
complement(1538366..1539667)
Genome map
AA seq 433 aa AA seqDB search
MKYYSTNKQASDATLEEAVVRGLAGDKGLYMPREIKPLPASFYDEIENLSFQEIAYRVAD
AFFGEDVPADVLKQIVYDTLSFDAPVVKVKDNIYSLELFHGPTLAFKDVGGRFMARLLGY
FIRKEGKKQVNVLVATSGDTGSAVANGFLGVEGIRVYVLYPKGKVSEIQEKQFTTLGQNI
TAIEVDGTFDDCQALVKNAFMDEELKAHMQLTSANSINVARFLPQAFYYFYAYAQMKKQG
KADNLVICVPSGNFGNITAGLFGKRMGLPVKRFIAANNRNDIFYQYLKTGVYTPRPSVAT
IANAMDVGDPSNFARILDLYGGSHEAISGEISGETYTDEQIRETVQKAYEETGYLLDPHG
ACGYRALAEGLKPGETGVFLETAHPAKFLQTVEAIIGTKVDIPEKLQAFMRGTKQSVPMP
KDFASFKAYLMKQ
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattacagtaccaataagcaggcttccgacgctacactggaagaagccgtagtg
cgcggactggcaggtgacaaagggctttacatgccccgcgaaatcaagcctttgcccgca
tcgttttacgatgagatagaaaacctttcgtttcaggaaatcgcttaccgcgtggcggac
gctttcttcggagaagatgtgccggcggatgtcttgaagcagattgtatatgacaccttg
agctttgatgcgccggtggtgaaggtgaaagacaatatctattcgctggagctcttccac
gggcctacgctggcgttcaaggacgtgggcggacgctttatggcacgcctcttgggctat
ttcatccgcaaggaaggaaagaagcaggtcaatgtactggtagctacgtcgggcgatacg
ggaagtgccgtggcaaacggtttcctgggtgtggaaggcattcgtgtgtatgtgctttac
ccgaaagggaaggtgagcgagatacaggaaaagcagttcaccacgctggggcagaacatc
accgccattgaggtggacggcacgttcgacgattgtcaggcactggtgaagaacgcgttt
atggacgaagagctgaaggcgcacatgcagctgacctctgccaattccatcaatgtggcg
cgcttcttgcctcaagctttctattatttttacgcttatgcccagatgaagaagcagggc
aaggcggacaatctggtcatctgcgtgcccagcgggaacttcggaaacattacggcaggg
cttttcggcaaacggatggggcttccggtaaaacgctttatcgccgccaataaccgcaat
gatattttctatcaatacttgaagacgggtgtctatacgccgcgtccttcggtagcgacc
attgccaatgccatggatgtgggcgaccccagcaacttcgcccgtatcctcgacttatac
ggaggaagccacgaggctatttccggcgaaatcagtggcgagacttataccgatgagcag
attcgcgaaaccgtgcagaaggcttacgaggaaaccggatacctgctcgaccctcacggg
gcgtgcggctatcgtgcgctggcggaaggcttgaagccgggcgaaacgggagtgttcctc
gaaacagcccatccggcaaagttcttgcagacggtggaagccattatcggaaccaaggtg
gatatccccgaaaagcttcaggcgtttatgcgcggcacgaagcaaagcgtcccgatgccg
aaagacttcgcttcattcaaggcatacttgatgaaacagtaa

DBGET integrated database retrieval system