KEGG   Bacteroides salanitronis: Bacsa_1415Help
Entry
Bacsa_1415        CDS       T01433                                 

Definition
Galactosylceramidase (EC:3.2.1.46)
Orthology
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
bsa  Bacteroides salanitronis
Pathway
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bsa00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1583511..1585649)
Genome map
AA seq 712 aa AA seqDB search
MNKLRKLIIGLVIGLSLPALAAIPYSYGQEQTIRLDGNAGGKRFDGIGVVNGGGATSVLL
KDYPEPQRSQILDMVYKPKFGASISALLVEIPGDGNSTQGSMPSHQHVRGDLNYSRGYTW
WILKEAKRRNPRLTLDGTAWSAPGWIGNGKFWSQDAADYYVSWLKGLRNVYGLELTAIGC
RNEKGADYDFVKRLRRTLDANGFTDLRIHAFDNWNAGKLNFVKDMASDKELRDAIDIVSG
HVFYQGIPVSAEEKAMAEQLGKPIWNTEDHVYKKGFDCLISLVECFNENYIRYGVTKIVN
WYDIAGIYPLEPYAEDPPTVLAYEPWSGHFRVRKALWGYAHYGQFSEVGWEYLNDACTDL
AGGGSLVTLKSPQGDYSVIIETKDAKEAQTLHFTLSGPLSGENLCVWHSNEQEQFVRLND
IAVRDNEFTITVAPDAVYSLSTTTGQQKGSYSAPASRPFPFPYYETFEQYEHPEHYGYLP
RYTADICGAFEIADRPDGTGKCMRQAVPAPTISWAPDWKPYTIIGDSAWTDYEVSADVYL
NPGDTAGIMGRINDVGSGYGFIPKGYYLQLADDGQCRLVVVRGKVDKKALVGDAEQQALI
KRNKDTSEGGEKLLASAKLPGISSKKWYNLKLRFKGNELTGFVDGKQILKVEDALYAYGM
AGLLAGQSEDKTSTPYFDNLCITPIGESVSTPTPPSANQIPIYENSASDDIE
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaactgagaaaactgattatcgggctggttatcggcttaagcttgccggcattg
gctgctattccatatagctacggacaagaacagacgattcgattagatggtaatgccgga
ggcaaacgcttcgacggcatcggtgtggtgaacggaggaggagctacttccgtattgttg
aaagactatccggaacctcagcgcagccagatattggatatggtgtataaacccaaattc
ggtgcgtcgatcagtgccttgctggtggagattccgggtgacggcaattctacgcaaggc
tctatgcccagtcaccaacatgtgcggggcgacttgaattattcgcgcggctatacgtgg
tggatactgaaagaggcaaagagacgaaaccctcgcctgacgcttgacggaacggcttgg
agtgctccgggttggattggaaacgggaagttttggtcgcaggatgcagccgattattat
gtaagttggctgaaaggcttgcgcaatgtatatgggctggaacttacggctatcggttgc
cgcaacgaaaagggagcagactatgatttcgtaaaacgcttgcggcggacattggatgcc
aacggtttcacagaccttaggattcacgccttcgacaattggaatgccggaaaactgaat
tttgtgaaagacatggcttccgataaggaattgcgggacgctatcgacattgtcagcggt
catgtcttttaccaaggcataccggtttcggcagaggaaaaggcgatggcagagcaattg
ggcaagccgatatggaataccgaagaccatgtgtataaaaaaggatttgattgcctgatt
agtctggtggaatgcttcaacgaaaactacatccgctatggagttaccaaaatcgtaaac
tggtatgacattgccggcatctacccgttagagccttatgcggaagaccctcctacggta
ttggcatacgagccttggagtggacatttccgggtgcgtaaggcattatgggggtatgcg
cattacggacagttctccgaagtgggatgggaatatctcaacgacgcatgcacagatttg
gctggcggcgggtcattggttaccttgaaatccccgcaaggagattatagcgtgattata
gagaccaaggatgccaaagaagcgcagacgctgcacttcacattgtcaggtcctctttcg
ggagagaatttatgtgtgtggcatagcaacgaacaagaacaattcgtccgtctgaatgac
attgcagtaagggataacgaatttacgataacggtagctcccgatgccgtttattcgctt
tctactactaccggtcagcaaaaaggctcgtattccgctccggcatcccggcctttcccg
tttccctattacgagacattcgaacaatacgaacatccggaacactatggctacttgcct
cgctataccgctgatatttgtggtgcatttgaaatagccgaccgtcctgacggaacggga
aaatgcatgcgtcaagcagtgccggcgcctactatctcgtgggcacccgattggaaacct
tataccattataggtgattccgcctggacagactatgaggtcagtgctgatgtatacctc
aatccgggtgacacggcaggcattatggggcgcatcaacgatgtgggaagcggttatggc
tttattcccaaaggatactatttgcaattggcagatgatggacaatgccggttggtggtg
gtcagaggcaaggttgataagaaagccttggtgggcgatgccgaacaacaggctctcatc
aagcggaataaggatacaagcgaaggaggtgagaagctgttggcttccgcaaagctgccc
ggcatatcgtccaagaaatggtacaacctgaaattacggttcaaaggaaacgagctgacc
ggatttgttgatgggaaacagattctgaaagttgaagatgcattatatgcttacggtatg
gcaggactacttgccggacaatcagaggacaaaaccagcacaccttattttgataatctg
tgcattactcccataggcgagagcgtttctacaccaactccgccttccgcgaatcaaatt
ccaatttatgaaaacagtgcttctgatgatattgaataa

DBGET integrated database retrieval system