KEGG   Bacteroides salanitronis: Bacsa_1464Help
Entry
Bacsa_1464        CDS       T01433                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bsa  Bacteroides salanitronis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bacsa_1464
Enzymes [BR:bsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Bacsa_1464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1634397..1635554
Genome map
AA seq 385 aa AA seqDB search
MKRQIAILGSTGSIGTQALQVIKEHPDLYEVYALTANNQVDLLARQAREFQPEAVVIANE
DKYPALKEALSDLPVKVYAGKDALAQIVESQPIDIVLTAMVGYAGLLPTMNAIRAGKAIA
LANKETMVVAGEIINALAQEYHTPILPVDSEHSAIFQCLEVNNPVSKVILTASGGPFRTY
TIDQLRTVTKAQALHHPNWHMGAKITIDSASMMNKGFEVIEAKWLFGVRPEQIEVVVHPQ
SVIHSMVEFEDGAVKAQLGVPDMRLPIQYAFSYPKRVSLSGERLDFAKYNTLTFEKPDTE
RFRNLALAYEALHQGGNMPCIVNAANEVVVAAFLEDKISFLGMSEVIEKTMTRVPFIQRP
RYEDYVATDAETRRIAAELVINKMY
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagacaaatagcgatattaggttctacaggttctatcgggacacaagccttgcaa
gtcatcaaggagcatcccgacctgtacgaagtgtatgctcttacggcaaacaatcaggtg
gatttgcttgcccgacaggcacgcgagttccagcccgaagccgttgtgatagccaatgaa
gacaaatatccggcactgaaagaagcactctccgacttgcccgtaaaagtgtatgccgga
aaagacgcactggctcagattgtagaatcccaaccgattgacatcgttttaaccgctatg
gtgggctatgccggtctgctgccaacaatgaatgccatccgtgcgggaaaggccatcgcc
cttgccaataaggaaaccatggtcgtagcgggtgagattatcaatgctctggcacaagaa
tatcatacccctattcttccggtagactcggaacactcggctattttccaatgcctggag
gtgaacaatcctgtatcgaaggtgattcttaccgcgtcgggtggcccgttccgcacgtac
accatcgaccagctccgcacggtcaccaaggcgcaggctttgcatcatcccaactggcac
atgggagccaagataaccatcgactcggcttcgatgatgaacaagggcttcgaagtaatc
gaagccaaatggctcttcggcgtgcgccccgaacagattgaggtagtagtacatccccag
tcggtcatccactcgatggtggagttcgaggacggagcggtaaaagcccagttaggcgtg
cccgatatgcgtctgcccatccaatacgctttctcttaccccaagcgggtttccctttcg
ggagagcggctggactttgccaaatacaatacgctgactttcgagaagcccgacacggaa
cgtttccgcaacttggctttggcatacgaggcactgcatcagggaggcaacatgccctgc
atcgtaaatgccgccaatgaagtggtggttgcggcattcctggaagacaagatttcgttc
ctcggcatgagtgaggtcatcgagaaaaccatgacacgcgtgccgtttatccagcgcccg
aggtatgaagactatgtggctaccgatgccgaaacacggcgcattgccgcagaattggtg
ataaacaaaatgtattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system