KEGG   Bacteroides salanitronis: Bacsa_1546Help
Entry
Bacsa_1546        CDS       T01433                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
bsa  Bacteroides salanitronis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bsa01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:bsa00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1751537..1752811
Genome map
AA seq 424 aa AA seqDB search
MNIIRYPERAEWNNVLKRSALHTEDIRPAVQEIIGKVRTEGDRALYEYEEKFDKVKLASL
IVTPEEFDEAGKALESGLKEAILRALENIRAFHAAQKFESKKVETVPGVTCWQKAVPIEK
VGLYIPGGTAPLFSTVLMLATPAQIAGCKEIILCSPPNTEGKIHPAILFAAQAAGVKKVF
KAGGVQAIAAMAYGTESVPKVYKIFGPGNQYVTVAKQEVSLRDVAIDMPAGPSEVAVLAD
ETANPVFVASDLLSQAEHGVDSQAVLITTSETLLRETQAEVERQLAALPRKAITEKSLES
SRLILVKDLNEALDMVNEYAPEHLIIETKDYQDIAERVINAGSVFLGPYAPESAGDYASG
TNHTLPTNGYAKAYSGVSLDSFIRKITFQEITREGIRTLGPTIQVMAENEHLDAHKNAIT
VRLL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaacattatccgttatcctgaacgtgccgaatggaacaacgtgctgaaacgctcggca
ctacacaccgaagacatacgccctgccgtacaggaaattatcggcaaggtacgcacggaa
ggcgaccgtgccttatatgaatatgaagaaaagttcgacaaggtaaagctggcttcgctt
atcgtgactccagaagaatttgacgaagccggaaaagccctcgaaagcggactgaaggaa
gccatcctgcgcgccttggaaaatatccgcgcctttcatgccgcacaaaagttcgaaagc
aagaaagtggaaaccgttccgggtgtgacctgctggcaaaaggcggttcccatcgagaag
gtagggctgtacatcccgggcggaacggctcccctcttctctaccgtcctgatgctcgcc
actccggcacaaatagccggatgcaaggaaatcatactctgctcgcctcccaatacggaa
ggaaagatacaccccgccatcctgtttgcggcgcaagcggcaggcgtaaaaaaggtgttc
aaagccggaggcgtacaagccatagctgccatggcatacggaacggaaagcgttcccaag
gtatataagatattcggaccgggaaaccaatatgtcactgttgccaagcaggaagtatcc
ttgcgcgacgtggcgatagacatgcctgcgggtccttcggaggtggctgtacttgccgac
gagaccgccaatccggtattcgtggcatccgacctcctttcgcaagccgagcatggcgtg
gatagccaggccgtcctgattacaacatccgaaaccttgctccgtgaaacccaagccgaa
gtggaacgccagcttgccgcactcccgcgcaaagccataaccgaaaaatcactggaatcg
agcaggctgatattggtgaaagacctgaacgaagcccttgatatggtaaacgaatatgct
cccgaacacctgattatcgaaacgaaagactatcaggacatcgccgaacgggtcatcaat
gcaggttcggtattcttaggcccgtatgcacccgaaagtgccggcgattatgcttcgggc
accaaccataccctgcctaccaacggatacgcaaaagcctatagcggagtaagcctggat
agctttatccgcaaaatcaccttccaggaaatcacccgcgaaggcatccgcaccttgggc
ccgaccattcaggttatggcagagaacgagcacctcgacgcgcataagaacgccataacg
gtacggcttttatag

DBGET integrated database retrieval system