KEGG   Bacteroides salanitronis: Bacsa_1546Help
Entry
Bacsa_1546        CDS       T01433                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
bsa  Bacteroides salanitronis
Pathway
bsa00340  Histidine metabolism
bsa01100  Metabolic pathways
bsa01110  Biosynthesis of secondary metabolites
bsa01230  Biosynthesis of amino acids
Module
bsa_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bsa00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Bacsa_1546
Enzymes [BR:bsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Bacsa_1546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh DUF5420
Motif
Other DBs
NCBI-ProteinID: ADY36118
JGI: Bacsa_1546
UniProt: F0QZL7
Position
1751537..1752811
Genome map
AA seq 424 aa AA seqDB search
MNIIRYPERAEWNNVLKRSALHTEDIRPAVQEIIGKVRTEGDRALYEYEEKFDKVKLASL
IVTPEEFDEAGKALESGLKEAILRALENIRAFHAAQKFESKKVETVPGVTCWQKAVPIEK
VGLYIPGGTAPLFSTVLMLATPAQIAGCKEIILCSPPNTEGKIHPAILFAAQAAGVKKVF
KAGGVQAIAAMAYGTESVPKVYKIFGPGNQYVTVAKQEVSLRDVAIDMPAGPSEVAVLAD
ETANPVFVASDLLSQAEHGVDSQAVLITTSETLLRETQAEVERQLAALPRKAITEKSLES
SRLILVKDLNEALDMVNEYAPEHLIIETKDYQDIAERVINAGSVFLGPYAPESAGDYASG
TNHTLPTNGYAKAYSGVSLDSFIRKITFQEITREGIRTLGPTIQVMAENEHLDAHKNAIT
VRLL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaacattatccgttatcctgaacgtgccgaatggaacaacgtgctgaaacgctcggca
ctacacaccgaagacatacgccctgccgtacaggaaattatcggcaaggtacgcacggaa
ggcgaccgtgccttatatgaatatgaagaaaagttcgacaaggtaaagctggcttcgctt
atcgtgactccagaagaatttgacgaagccggaaaagccctcgaaagcggactgaaggaa
gccatcctgcgcgccttggaaaatatccgcgcctttcatgccgcacaaaagttcgaaagc
aagaaagtggaaaccgttccgggtgtgacctgctggcaaaaggcggttcccatcgagaag
gtagggctgtacatcccgggcggaacggctcccctcttctctaccgtcctgatgctcgcc
actccggcacaaatagccggatgcaaggaaatcatactctgctcgcctcccaatacggaa
ggaaagatacaccccgccatcctgtttgcggcgcaagcggcaggcgtaaaaaaggtgttc
aaagccggaggcgtacaagccatagctgccatggcatacggaacggaaagcgttcccaag
gtatataagatattcggaccgggaaaccaatatgtcactgttgccaagcaggaagtatcc
ttgcgcgacgtggcgatagacatgcctgcgggtccttcggaggtggctgtacttgccgac
gagaccgccaatccggtattcgtggcatccgacctcctttcgcaagccgagcatggcgtg
gatagccaggccgtcctgattacaacatccgaaaccttgctccgtgaaacccaagccgaa
gtggaacgccagcttgccgcactcccgcgcaaagccataaccgaaaaatcactggaatcg
agcaggctgatattggtgaaagacctgaacgaagcccttgatatggtaaacgaatatgct
cccgaacacctgattatcgaaacgaaagactatcaggacatcgccgaacgggtcatcaat
gcaggttcggtattcttaggcccgtatgcacccgaaagtgccggcgattatgcttcgggc
accaaccataccctgcctaccaacggatacgcaaaagcctatagcggagtaagcctggat
agctttatccgcaaaatcaccttccaggaaatcacccgcgaaggcatccgcaccttgggc
ccgaccattcaggttatggcagagaacgagcacctcgacgcgcataagaacgccataacg
gtacggcttttatag

DBGET integrated database retrieval system