KEGG   Bacteroides salanitronis: Bacsa_1703Help
Entry
Bacsa_1703        CDS       T01433                                 

Definition
Alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bsa  Bacteroides salanitronis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bsa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Bacsa_1703
  Lipid metabolism
   00561 Glycerolipid metabolism
    Bacsa_1703
   00600 Sphingolipid metabolism
    Bacsa_1703
Enzymes [BR:bsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Bacsa_1703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1967188..1969401)
Genome map
AA seq 737 aa AA seqDB search
MKNMKAKVLLVAGASLFASGVWAQEQLVRLSTPETSLVIDAPQGGELKYVYYGTKLGDAD
LKQIDAVRTCNHAAYPVYGMNTPAETALSVCHADGNMSTQLVVESVATTDGDKTTEVSVR
LKDKVYPFYVNVCYRAYQDVDIIETWTEITNEEKKPVVLNQFASAYLPIRRGNVWLSSLY
GSWANEGRLAQEPLEPGMKVIKNKDGVRNSHTAHAEVMFSLDGRPQENVGRTIGAALCYT
GNYKLRIDTDDSEYHQFFAGINEDNSMYHLQKGETFKTPVLALTYSDEGLSGASRNFHRW
GRTYKLAHGDKPRKILLNSWEGVYFDINQQGMEQMMADIESMGGELFVMDDGWFGGKYQR
NTDNSSLGDWVVDTRKLPEGIEGLLRDAKKHHVGFGIWIEPEMSNTTSELYEKHPEWIVK
APQRDPVLGRGGTQVVLDLGNPEVQDFVFGVVDDLMSKYPEIEYIKWDANMAIMNHGSNY
LTADNQSHMYIEYHRGFESVCNRIRAKYPDLTIQACASGGGRANWGYLPWFDEFWVSDNT
DALQRIYMQWGTSYFFPAIAMASHISSAPNHQVFRTVPIKYRIDVAMSGRLGMEIQPKNM
TEEEKEICRKAIADYKMIRPVVQFGDIYRLVSPYDRLGVASLMYTSPEKDKAVFYWWKME
TFYNQHLPRVRMAGLDPAKMYRVKELNRIDNEPLPFEGKAYSGKFLMENGLEIPYTHKVD
YHKLNDYASRVLYLEAE
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacatgaaagctaaagtcttattagttgccggagcttcgcttttcgcttccggt
gtatgggcgcaagagcaacttgtgcgcctctctactcccgaaacctcgctggtgattgac
gcaccgcaagggggagaattgaaatatgtatattatggtacgaagctgggcgatgcggat
ctgaaacagattgatgcggtgcgtacgtgcaatcatgccgcttatccggtgtatggaatg
aatactccggcagaaacggcgctctcggtatgccatgccgacgggaacatgtcaacccag
ctggtggtggaaagcgtggctacgaccgatggggataagacaacggaagtttctgtccgc
ttgaaagataaggtgtatccattttatgtcaacgtatgttaccgggcttatcaggatgtg
gacatcattgagacctggaccgaaataacgaacgaagaaaagaaacctgtagtgctcaac
cagttcgcttcggcttacctgcccatccgcaggggaaatgtatggctctccagcctgtat
ggttcgtgggcgaacgaagggcgtttggctcaggaaccgttggagccgggcatgaaagtg
ataaagaacaaggacggggtgcgcaattcgcatacggcacatgccgaagtgatgttttcg
ctcgacggccgtccacaggaaaacgtagggcggaccattggtgcggcactttgctataca
ggaaattataagctccgtattgacaccgatgatagcgaataccaccagttctttgccggt
atcaatgaagataattccatgtatcatttgcagaaaggcgaaacgttcaagactccggtg
cttgcccttacttattcggacgaagggttgagcggagccagccggaactttcaccgctgg
ggacgcacttataagctggcgcatggagacaagcctcgcaaaatcctgctcaatagctgg
gaaggcgtttacttcgacatcaaccagcaaggcatggaacagatgatggcggacatcgaa
tcaatgggcggagaattgtttgtgatggatgacggatggttcggaggcaagtaccagcgc
aataccgataattcttcgttgggcgactgggtggtagatacccgtaagcttcccgaaggc
attgagggattgctccgtgacgcgaagaaacatcatgtgggattcggtatctggatagag
ccggaaatgtcgaatactacgagcgaactctacgagaagcatcccgaatggattgtgaaa
gctccccagcgcgacccagtattgggacgtggcggaacgcaggttgtacttgacctcggc
aatcccgaagtgcaggacttcgtgttcggcgtggtggatgacctgatgagcaagtatccc
gaaatcgagtatatcaagtgggacgccaatatggcgattatgaaccacggttcgaattac
ctgaccgctgacaaccaaagccacatgtacatcgagtatcatcgtggcttcgagagtgta
tgcaaccgtatccgtgccaaataccctgaccttactatccaggcttgtgccagcggcgga
ggacgtgccaactggggttacctgccttggttcgacgagttctgggtgagcgacaatact
gatgccctccagcgcatttacatgcaatggggcacctcgtatttcttcccggcgatagcc
atggcgtcccacatcagttcggctcccaatcatcaggtcttccgtaccgttcctatcaaa
taccgtatcgatgtggcgatgagcgggcgtctgggcatggaaatccagccaaagaacatg
accgaggaggagaaggagatttgccggaaggcaatagccgattacaagatgattcgtccc
gtagtgcagttcggggacatctaccgtctggtttctccctacgaccgcttgggggtggcg
tctctgatgtatacttcgcccgagaaagacaaggcggtattctattggtggaaaatggaa
acgttttataaccagcatttgccacgtgtgcgcatggcagggctcgacccggcgaagatg
tatcgggtcaaagagttgaaccgcatcgataacgagcctctcccgttcgaggggaaagcg
tattcgggcaagttcttgatggaaaacggcttggaaatcccttacacgcataaggtggac
tatcacaagctgaatgattatgccagccgggtgctgtatctcgaagcggaataa

DBGET integrated database retrieval system