KEGG   Bacteroides salanitronis: Bacsa_1879Help
Entry
Bacsa_1879        CDS       T01433                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bsa  Bacteroides salanitronis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bsa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bacsa_1879
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Bacsa_1879
Enzymes [BR:bsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Bacsa_1879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2176281..2177363
Genome map
AA seq 360 aa AA seqDB search
MNYPYNRITVKIGSNVLTRKDGTLDVTRMSALVDQVAELHKAGVEVVLVSSGAVASGRSE
IKVSRKLDSVDQRQLYSAVGQAKLINRYYELFREHGIAVGQVLTTKESFGTRRHYLNQRH
CMQVMLENGVIPIVNENDTISVTELMFTDNDELSGLVASMLDAQALIILSNIDGIYNGSP
SEPGTSVIREVEQGKDLSDYIQAEKSGFGRGGMLTKTTIARKVADEGITVIIANGKRDNI
LTDLLEHPADTVCTRFVPASEAVSSVKKWIAHSEGFAKGELHLNAQAVEALKGKKAISIL
PVGVTRIEGDFEKDDIVRIMDAGGNQIGVGRIGASSEEARKMQGEHGQRPLVHYDYLYLD
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaactatccatataaccggataacggtaaaaatagggagcaacgtgctgacgcggaag
gacgggacactggacgtaacccgcatgtcggcactggtcgaccaagtggcagaactgcac
aaggcaggagtcgaggtggtactggtctcgtcgggagcggtcgcctcgggacggagtgag
ataaaagtatcgcgtaagctggacagcgtagaccagcggcaactgtattccgccgtaggg
caggcgaagttgataaaccgttattacgaactgttccgcgaacacggcatcgccgtaggg
caagtgctgaccaccaaagaaagcttcggcacacgccggcattacctgaaccaacggcat
tgcatgcaggtgatgctggagaacggcgtgattccgattgtcaacgaaaacgataccata
tcggtcaccgaactgatgtttaccgataacgatgagctttcggggctggtggcgtcgatg
ctcgacgcacaagccttgattatcctgagcaacatagacggcatctacaacggctcgcct
tccgagccgggcacttcggtgatacgcgaggtggagcaagggaaagacctttccgactat
atccaagccgagaagtcgggcttcggaagaggagggatgctcaccaaaaccacgattgca
cgcaaagtggcagacgagggcattacggtgattatcgccaacgggaagcgcgacaatatc
ctgacagacttgctggagcaccctgccgacacggtttgcacccgcttcgtacccgcctcc
gaagccgtatcgagcgtaaagaaatggattgcccatagcgaagggttcgccaagggggaa
ttacacctcaatgctcaagcggtagaggcgttaaaaggcaaaaaagccatcagcatcctt
cccgtaggcgtgacacgcatcgaaggggatttcgaaaaagacgacattgtgcggattatg
gatgccggcgggaaccaaataggcgtgggacgcatcggggcaagttcggaagaagcccgc
aagatgcagggcgagcacgggcagcgccctttggtgcattacgattacttgtacttggat
taa

DBGET integrated database retrieval system