KEGG   Bacteroides salanitronis: Bacsa_1885Help
Entry
Bacsa_1885        CDS       T01433                                 

Definition
(GenBank) Butyrate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bsa  Bacteroides salanitronis
Pathway
bsa00010  Glycolysis / Gluconeogenesis
bsa00620  Pyruvate metabolism
bsa00640  Propanoate metabolism
bsa00680  Methane metabolism
bsa01100  Metabolic pathways
bsa01110  Biosynthesis of secondary metabolites
bsa01120  Microbial metabolism in diverse environments
bsa01130  Biosynthesis of antibiotics
bsa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bacsa_1885
   00620 Pyruvate metabolism
    Bacsa_1885
   00640 Propanoate metabolism
    Bacsa_1885
  Energy metabolism
   00680 Methane metabolism
    Bacsa_1885
Enzymes [BR:bsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Bacsa_1885
Lipid biosynthesis proteins [BR:bsa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Bacsa_1885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADY36442
JGI: Bacsa_1885
UniProt: F0R2B3
Position
2183175..2184830
Genome map
AA seq 551 aa AA seqDB search
MLERFVSQTTFSSQEDFIKNFRVNVPENFNFGYDIVDAWAAERPEKNALLWTNDKGECIQ
FTYADLKKYTDMTASYFQSLGIGKGDKVMLILKRRYEFWFSIIALHKIGAVAIPATHLLT
KKDIVYRCQAATIKMIVAAGEGVILKHIVDAMPQSPSVEKLVSVGPEYPEGFEDFHKGIE
NAAPFTRPVNVNTNDDIMLMYFTSGTTGEPKMVAHDFTYPLGHITTASFWHNLHEDSLHF
TIADTGWGKAVWGKLYGQMIAGANIFVYDHEKFTPSDILKKIHDYHITSLCAPPTIYRFL
IREDLSKYDLSSLEYCTTAGEALNYSVYETFLKITGIRLMEGFGQTETTLTLATFPWMEP
KPGSMGVPNPQYQIDLLKPDGRSAEDGEQGQIVIRTDKGKPLGLFKEYYRAPELTREAWH
DGVYYTGDVAWRDEDGYYWFVGRADDVIKSSGYRIGPFEVESALMTHPAVVECAITGVPD
EIRGQVVKATIVLAKDYKAKAGPDLIKELQDHVKRVTAPYKYPRVIEFVEELPKTISGKI
RRVEIREKDNG
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaagatttgtaagtcagacaactttctcctcgcaagaggatttcatcaagaat
tttagagtaaatgtgcctgagaatttcaatttcgggtacgacatcgtggatgcttgggca
gcagaacgtccggaaaagaatgcactgttgtggaccaatgacaaaggcgaatgtatccag
ttcacttacgctgatttgaagaaatataccgatatgaccgcttcttatttccagagtctg
ggaataggcaagggcgacaaagtgatgttgatattgaaacgccgctatgagttctggttt
tcgattatcgctttgcacaagataggagctgtggcgatccccgctacccacctgctgacg
aagaaagacattgtctatcggtgtcaggcagctaccatcaagatgattgtagctgcgggt
gaaggagtgattctgaaacatatcgtagatgcaatgcctcagtcacccagcgtagaaaaa
ctggtcagcgtaggtcctgagtatcccgaaggatttgaggattttcataaaggcatcgaa
aatgctgcacctttcacacgtcccgtgaatgtaaacaccaacgatgacatcatgttgatg
tacttcacctcgggcactaccggcgaaccgaagatggtggcacacgatttcacctatcct
ttgggacatatcactacggcgagcttctggcataacctgcacgaagacagcctgcatttt
accattgccgatacaggctggggcaaggctgtatggggaaaactgtatgggcagatgata
gcaggggctaacattttcgtctacgaccacgagaagtttacaccttctgatattctgaag
aagattcacgattatcacatcacttcactttgtgcacctcccaccatttaccgcttcctt
atccgtgaggacttgagcaaatacgacttgtcttcattggagtattgtaccacggcgggt
gaggcgttgaactattcggtttacgaaacctttttgaagataacaggcatccgcttgatg
gaaggctttggacagaccgaaactaccttgacacttgccactttcccgtggatggaaccc
aagccgggaagcatgggcgtgcctaatcctcaatatcagatagacctgttgaagcctgac
ggccgctctgccgaggatggcgaacaaggacaaattgtgatacgtactgacaaaggcaaa
ccgctggggttgttcaaggaatattatcgtgcgcccgaactgacccgtgaggcttggcac
gatggagtatattacaccggtgatgtggcttggcgtgacgaagatggttactattggttt
gtaggacgtgccgatgatgtcatcaagagttcagggtatcgcattggtccgttcgaagtg
gaaagtgccctgatgacccatcctgcagtggtagagtgtgccataacgggagtgcctgat
gaaatccgcggtcaggtggtgaaggctaccattgtattggcaaaagattataaggcaaaa
gccggtcccgacttgataaaggaacttcaggatcatgtgaagcgggtaaccgctccttat
aaatatccgcgtgtgatagaatttgtcgaagaattgcctaagactatcagcgggaaaatc
cgccgcgtggaaatccgggaaaaggacaatggataa

DBGET integrated database retrieval system