KEGG   Bacteroides salanitronis: Bacsa_1967Help
Entry
Bacsa_1967        CDS       T01433                                 

Definition
Arginase/agmatinase/formiminoglutamase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bsa  Bacteroides salanitronis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bacsa_1967
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Bacsa_1967
Enzymes [BR:bsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Bacsa_1967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2276007..2276987
Genome map
AA seq 326 aa AA seqDB search
MDRHRFLKQMLLFTALLYGTSFPAKAQNNEITMDNNQRTKTIRLVYPQWQGGDIAHWITE
VKDPEQASRGYYLGAQLLNFLAPDNGQETYTVPVATDKIGRKVTDGVLDKEALIAQTRAA
LDILKITHPDKIVTLGGECSVSVVPFTYLADKYKDDLAMVWIDAHPDITLPGDAYAGYHA
MAVTACMGLGDKQLVSELPMKIDPSKILFVGLRDWERDEIKARQEQYGIQHLTPKDVREN
SDAVRQWLQSCGASKVVIHFDMDVLDPAEIIAAVGVVPDGMKIAEVVRVINDIGQEKDIV
GLTVAEPMPRTAIRIKNMLEQLPLLK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggacagacacagattcctgaagcaaatgctattattcaccgccttgttgtatgggaca
tcgtttcctgccaaggcacaaaataacgaaatcaccatggataataatcaacgtacaaaa
accatccggctggtttatccgcagtggcaaggtggagacatcgcccactggataacggaa
gtgaaagacccggagcaggcttcgaggggatattaccttggggcgcagttgctgaatttc
cttgcaccggacaacgggcaagaaacctatacggttcctgtggcaaccgacaagatagga
cgtaaagtaaccgacggcgttttggacaaagaggcactcatcgcacagactcgagcagct
ttggatattctgaaaataacccatcctgataaaatcgtaacactgggcggagaatgttcg
gtaagcgtcgttccatttacctaccttgcggacaaatacaaggatgaccttgcaatggtc
tggattgacgcacatccggacattaccttgcccggcgatgcctatgcgggctatcatgct
atggcggtaacagcctgcatgggcttgggcgacaaacagcttgtttctgaactgccgatg
aagatagacccttccaaaatcctttttgtcggattgcgcgattgggagcgtgacgaaatc
aaggcaaggcaggaacaatacggcatccaacacctgacaccgaaagatgtccgcgagaac
agtgatgcggtacggcaatggttacaatcgtgcggagcatccaaggttgtcatacacttt
gatatggatgtactcgacccggcggaaatcatcgcggcggtcggtgtggtcccggatgga
atgaaaatcgcagaagtggtgcgtgtgataaacgatatcgggcaggaaaaggatattgtc
gggctgaccgtagccgaacctatgccccgcacagccatccgcattaagaacatgctggag
cagcttccgctattgaaataa

DBGET integrated database retrieval system