KEGG   Bacteroides salanitronis: Bacsa_2044Help
Entry
Bacsa_2044        CDS       T01433                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bsa  Bacteroides salanitronis
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bacsa_2044
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Bacsa_2044
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bacsa_2044
Enzymes [BR:bsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Bacsa_2044
Exosome [BR:bsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bacsa_2044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2346987..2348396)
Genome map
AA seq 469 aa AA seqDB search
MKKISFFLFCLLLASFVHAQQAKYVFFFIGDGMGVNQVQGTELYLGELDGKIAIAPLDFT
EFPYATTSSTYSATNGVTDSAAGGTALATGKKTMNGVIGMEKDQQTPVASIAMRAKEKGF
RVGVATSVSVDHATPAAFYAHNPSRKNYYQIGKDLFLAGFDFYAGSDFLDPDNQGKSESL
YSLAQKNGYTLARGYDDFVSKSDKADKLILFQTEEASKVHRDAIPYAIDRKEGDLALSDI
TGAAIRFLSKDLSKGFFLMVEGGKIDWACHSNDAATAFREVMDLNESVRQALQFYEEHPD
ETLIVISADHETGGLVLGTGEYALNLQALQYQRVSETGFTSILNGLRRQTGNRVAWEQVE
EALKANFGFWNEVKLTEAQEKRLRDVFDRTFTGESVEMEKSEYAQDEPLAAEAVRVLNEI
ALIGWVSGGHSAGYVPVFAIGAGADLFQGRMDNIEIPARIAEAAGYVAE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatttcattcttcttgttttgtcttttgcttgcttcgtttgttcatgcccag
caggcaaaatatgtattcttctttatcggtgacggtatgggagtcaatcaggtacaggga
accgaactttatttgggtgagttggatggtaaaatagcgattgctccgcttgattttaca
gagtttccgtatgcaactacaagttctacttattcggcgacgaatggagtgaccgactct
gccgccggaggtacggctctcgctacgggcaagaaaaccatgaatggggttatcggtatg
gagaaagaccagcagacacctgttgcaagcattgcgatgcgggcaaaagaaaagggattc
cgtgtgggggtcgctacaagtgtaagcgtagaccatgccactcctgccgctttttatgcc
cataaccccagccggaaaaactattatcagataggaaaagatttgttcctcgccggtttt
gatttttatgccggttctgatttccttgacccggataaccaggggaaatcggaaagcctt
tattcgttggctcaaaagaatggttatacccttgcgcgtggatacgatgatttcgtgtcg
aagagcgataaggcagacaagctgattctcttccagaccgaagaggcgtcgaaggtacat
cgtgatgccattccgtatgccatcgaccgtaaggaaggggatcttgctttgagcgatatt
accggtgcggctatccgtttcctttcaaaggatttgagcaagggatttttcttgatggta
gaaggagggaaaatcgactgggcatgccatagcaacgatgccgctactgctttccgtgag
gtaatggatttgaacgagtctgtccgtcaggcacttcagttctatgaagagcaccccgat
gaaacccttatcgtcatcagtgccgaccatgagacaggaggtctggtattgggtacgggc
gaatatgcgcttaacctgcaggctctgcaataccagcgggtaagcgaaaccggattcact
tctattctgaacggtttgcgtcggcagaccgggaatcgtgtggcttgggaacaggtagag
gaggctttgaaggctaatttcggattttggaatgaggtgaaattgaccgaggcgcaagaa
aaaagattgcgtgacgtattcgaccgtacgtttacgggagaaagcgtggaaatggagaag
agtgaatatgcgcaggacgagcctttggcggcagaagccgtgcgcgtgcttaatgagatt
gccctgataggttgggtgagcggaggccattcggctggttatgttccggttttcgccatc
ggggccggagccgaccttttccaagggcgcatggataatatcgagattcctgcacgcatc
gccgaagcggcagggtatgtagcagaataa

DBGET integrated database retrieval system