KEGG   Bacteroides salanitronis: Bacsa_2334Help
Entry
Bacsa_2334        CDS       T01433                                 

Definition
DNA protecting protein DprA
Orthology
K04096  
DNA processing protein
Organism
bsa  Bacteroides salanitronis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2714093..2715205)
Genome map
AA seq 370 aa AA seqDB search
MNTNETLYRLALTQLPGIGVGHAHNLLQAAGNATVLFEHRKELPDILPDIPVRLIQAFDH
PEVLRRCEAELSFAEKNRIACLTEEDEAYPSRLRECNDAPLVLFYKGTADLNRRHVISMV
GTRNATDYGKDLCLRFVRELKERLPDAIIVSGLAYGIDIHAHRAALQYGLDTIGVLAHGL
DRIYPFVHRNTASEMTLHGGLLTEFMSGTNPDKQNFVKRNRIVAGISDATIVVESAKKGG
SLITAEIAESYHRDCFAFPGRVGDVFSEGCNYLISANRAVLLQSAEELVKAMNWDCPKEL
PSAIQRQLFPELNPEEARIVQIMRKYPEGIQVNSLVVESNIAITGMTGILFELELKGVVK
SLAGGMYRLI
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaaatgaaacgctttaccggttggctttgactcaattgcccggcatcggagtc
ggccatgcccataaccttctgcaagccgcaggaaacgctacggtactcttcgaacatcgg
aaagaacttccggacattttgccggacatccctgtgcggcttatccaggcattcgaccat
ccggaagtgctcagacggtgcgaggctgaactttcctttgccgaaaagaaccggatagcc
tgcctcacggaagaagacgaggcatatccttcccgcctaagagaatgcaacgatgcgccg
ctcgtcctcttttataaaggaacggccgacctgaaccggcggcatgtcatcagcatggta
ggaacacgcaatgccaccgattatggcaaggatttatgtctccgtttcgtgcgcgaactg
aaagagcggcttcccgatgcaatcatcgtgagcgggctggcgtatggcatcgacatccac
gcacatcgcgctgccctgcaatacgggctggataccattggcgtactggctcacggactg
gaccggatttacccgttcgtacaccggaataccgcttcggaaatgaccttacacggcggg
ttattaaccgaattcatgagcgggacgaatccggacaagcagaacttcgtcaagcgcaac
cgtatcgtagcagggataagcgatgccaccattgtagtggaatcggcaaaaaaaggaggt
tcgcttattacggcagagatagcggaaagctaccaccgggattgttttgcttttcccggc
agggtaggagatgtcttttcggagggatgcaactacctgattagcgccaatcgcgccgtt
cttttgcaaagcgcggaagagttggtaaaagccatgaattgggattgccccaaagaactc
ccgtccgccatccaacgccaactcttccccgaactgaatcccgaagaggcacgcatcgtc
caaatcatgcggaaataccccgaaggcattcaggtgaacagccttgtggtagagagcaac
atcgctatcaccggcatgaccggtattcttttcgaactggaactgaaaggagtggtcaag
agccttgcaggaggcatgtaccgattaatttga

DBGET integrated database retrieval system