KEGG   Bacteroides salanitronis: Bacsa_2490Help
Entry
Bacsa_2490        CDS       T01433                                 

Definition
(GenBank) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bsa  Bacteroides salanitronis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bacsa_2490
   01230 Biosynthesis of amino acids
    Bacsa_2490
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bacsa_2490
   00051 Fructose and mannose metabolism
    Bacsa_2490
   00562 Inositol phosphate metabolism
    Bacsa_2490
Enzymes [BR:bsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bacsa_2490
Exosome [BR:bsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bacsa_2490
  Exosomal proteins of bladder cancer cells
   Bacsa_2490
  Exosomal proteins of melanoma cells
   Bacsa_2490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2897220..2897975
Genome map
AA seq 251 aa AA seqDB search
MRKNIVAGNWKMNKNLQEGIALAKELNEVLSADKPNCDVIICTPFIHLASVTPIVDKSII
GVGAENCADKASGAYTGEVSAEMVASTGAQYVILGHSERRAYYHETVDILTEKVKLALAN
NLKPIFCIGEVLEEREANKQNEVVEAQLASVFSLSAEDFGKVILAYEPVWAIGTGKTATP
EQAEEIHAHIRSLVAAKYGQEVAENTSILYGGSCKPSNAKELFAKPDVDGGLIGGAALKA
ADFKGIIDAFK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagaacattgtagcaggaaactggaaaatgaacaagaacctgcaagaaggtatt
gctttggcaaaagaactgaacgaagtgttgagcgcagacaaacccaattgtgatgtcatc
atctgtactccgttcatccacttggcttctgtaactccgatagttgacaagagcatcatc
ggtgtaggtgccgagaactgtgccgacaaggcttcgggcgcgtatacaggcgaagtatca
gccgaaatggtcgcttctaccggtgctcaatacgttatcttgggccactcggaacgccgc
gcttattatcatgaaaccgttgatatcctgaccgaaaaggttaaattggctttggctaat
aacctgaagcctatcttctgcatcggtgaagtattggaagaacgcgaagcaaacaagcag
aacgaagtggtagaggctcagctggcttctgtattctcgctctctgccgaagacttcggc
aaggttatcttggcttacgaaccggtttgggctatcggtacgggcaagaccgctactccg
gaacaagcagaagaaatccacgcgcacatccgttcgctggtagctgctaagtacggtcag
gaagtggcagaaaacacttctatcctgtacggaggaagctgcaagccgtcgaatgcgaaa
gaactgttcgctaaacccgatgtagacggtggcttgattggcggtgccgcattgaaagcc
gctgacttcaagggcattattgatgcgttcaaataa

DBGET integrated database retrieval system