KEGG   Bacteroides salanitronis: Bacsa_2580Help
Entry
Bacsa_2580        CDS       T01433                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bsa  Bacteroides salanitronis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bsa03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2993235..2993834
Genome map
AA seq 199 aa AA seqDB search
MIEYIKGELAEAAPAFAVVDCNGVGYGINISLNTYSAIQGKKEVKLFIYEAIREDAYVLY
GFSTKQERELFLLLISVPGIGGNTARMILSALSPRELCNVISTGNDKLLKTVKGIGLKTA
QRIIVDLKDKIASTGIEEEASTVSSLSHTVNTEIYEEAVAALVMLGFAQAPSQKAVASIL
KAEPDAAVERVIKLALKML
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgattgaatacatcaaaggagaacttgccgaagcggcaccggcttttgcggtggtagat
tgtaatggggtagggtatggcattaatatatcgcttaatacctattctgccatacaaggg
aagaaagaggtgaaactgtttatttacgaggcaatccgcgaagatgcgtatgtgctttac
ggtttttcaacgaagcaggagcgcgaactttttcttttgcttatcagcgtgccgggtatc
gggggcaataccgcacgcatgattctttcggcgctttctcctcgcgaattatgcaacgtc
atcagtacgggcaacgataaattgctgaaaacggtaaaaggtatcggattgaaaaccgcc
cagcgcatcatcgtagacttgaaagacaagattgcttcgacgggcattgaagaagaggca
agtacggtatcttctctttcgcataccgtcaacaccgaaatctacgaagaagccgtggcg
gctcttgtcatgttgggattcgcacaggctccttcgcaaaaagcggtggcaagcatcctg
aaagccgaacccgatgcagccgttgagcgggtgattaagctggctttgaagatgctgtaa

DBGET integrated database retrieval system